KEGG   Azorhizobium caulinodans: AZC_3174Help
Entry
AZC_3174          CDS       T00609                                 

Definition
(GenBank) NLPA lipoprotein precursor
  KO
K02073  D-methionine transport system substrate-binding protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc02010  ABC transporters
Module
azc_M00238  D-Methionine transport system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AZC_3174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3174
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   D-Methionine transporter [MD:M00238] [OT]
    AZC_3174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipoprotein_9 SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: BAF89172
RhizoBase: AZC_3174
UniProt: A8IC84
Position
3629340..3630230
Genome map
AA seq 296 aa AA seqDB search
MPARTFVDRLSQHSDSSHAKGKGMSLLHGLRKSVLALAGILALVASEGAVAQTADKPLKV
GVSAGPYGDILREAAKVAAKDGLKAEIIEFTDWNQPNAALQAGDIDLNNFQHRFYLANQI
KARGYQLVALDESILVPAGLYSKSYTKIADIPDGAKIAIPNDPTNAARALLLFQRAGLLK
LKPTTGLNATVLDVESNPKKLQILEIDAAQLPRSLDDVAVAFVSSNYAYLAGLSLRKALL
AETEVAESKPYFTLIFAACEDRKDDPRIKAFIAAYRSQAVKDFIVEKFNGTIQPAW
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgcgcgcacatttgtcgacagattaagtcagcattcagattcctctcacgcgaaa
ggcaagggcatgtcgcttctccacggtctgcggaaatcggttctggcgctggccggcatt
ctcgcactcgttgcgagcgagggggccgtggcccagacagctgacaagccgctcaaggtg
ggcgtctcggccggcccctatggcgacatcctgcgcgaggcggcgaaggtggccgcgaag
gacgggctgaaagcggagatcatcgagttcaccgactggaaccagcccaatgcggcgctc
caggccggcgacatcgacctcaacaatttccagcaccgcttttatctggccaatcagatc
aaggcgcggggctatcagctggtggcgctggacgaatccatcctcgtgcccgccggcctc
tattccaagagctacaccaagatcgccgacattcccgatggcgcgaagatcgccattccc
aacgacccgacgaacgccgcgcgggccctgctgctgttccagagggccggattgctgaag
ctcaagcccaccaccgggctcaacgccaccgtgctcgacgtggaaagcaatccgaagaag
ctgcagatcctggagatcgacgccgcccagctgccgcgctcgctggatgatgtggcggtc
gcgttcgtgtccagcaattacgcctatctggcgggcctcagcctgcgcaaggcactgctg
gcggaaacggaagtggcggaatccaagccctatttcaccctcatcttcgccgcctgcgag
gaccgcaaggacgacccgcgcatcaaggccttcatcgccgcctaccgctcgcaggcggtg
aaggatttcatcgtcgagaagttcaacggcaccatccagcccgcctggtag

DBGET integrated database retrieval system