KEGG   Azorhizobium caulinodans: AZC_3177Help
Entry
AZC_3177          CDS       T00609                                 

Definition
(GenBank) putative sulfate ester transport system substrate-binding protein precursor
  KO
K15553  sulfonate transport system substrate-binding protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc00920  Sulfur metabolism
azc02010  ABC transporters
Module
azc_M00436  Sulfonate transport system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AZC_3177
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AZC_3177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3177
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfonate transporter [MD:M00436]
    AZC_3177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 NMT1_2 Phosphonate-bd SBP_bac_3 NMT1_3 Lipoprotein_9 YhfZ_C
Motif
Other DBs
NCBI-ProteinID: BAF89175
RhizoBase: AZC_3177
UniProt: A8IC91
Position
3632595..3633671
Genome map
AA seq 358 aa AA seqDB search
MSRPASLLARLAAAGGLLLAAFAPAAAEPVTIRIGYAAIGVDNRPYAEGTSAATARAGNY
VEDAFAGNPDIKVEWYFFKGAGPAVNEAIANGQLDFAYQGDLPSIIGRANGLKTKLLLAS
GAHKPTYIAAPLNSGLTGIKDLKGRKVAVQLGTNNHLAFAKILKAYGVSERDLQIVNMDS
ASANAALASGDIDAAVGDTTLITLAEKKIAKIVYTTKGDDPRLGRYAHVLVTEAFEKAHP
DLTQKVTTAFVKAAHWSSEEPNREALIALWGKSGTSTSVLTEFFSGETLKYRNTPLIDDL
FIDQYTQAAAQSKAFGLLRRDVDLTGWFDTSYLNTALKELKLEGYWTPYGADGKPLGS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcccgcttcccttctcgcccgccttgccgccgccggtggcctgctgcttgcc
gcgttcgcgccggcggcggccgagcccgtcaccatccgcatcggctacgccgccatcggc
gtcgataaccggccctatgcggaaggcacctccgccgccacggcgcgtgcgggcaattac
gtcgaggacgcctttgccggaaatcccgacatcaaggtggagtggtatttcttcaagggc
gccggcccggccgtgaacgaggccatcgccaatggccagcttgatttcgcctatcagggc
gacctgccctccatcatcggccgggccaatggcctcaagaccaagctgctgctggcgagc
ggcgcccacaagcccacctatatcgccgccccgctcaattccggcctgaccggcatcaag
gacctcaagggacgcaaggtggcggtgcagctcggcaccaacaaccatctcgccttcgcc
aagatcctcaaggcctatggcgtgtccgagcgtgaccttcagatcgtgaacatggattcg
gcttccgccaatgcggcgctggccagcggcgacatcgatgcggcggtgggcgacacgacg
ctcatcacgctggcggagaagaagatcgccaagatcgtctacaccaccaagggtgatgat
ccgcgcctcggccgctacgcccatgtcctggtgacggaggccttcgagaaggcccatccc
gaccttacgcagaaggtcacgactgccttcgtgaaggcggcccactggtcctccgaggag
ccgaaccgcgaggcgctcatcgccctgtggggcaagtccggcacctccacctcggtgctg
acggagttcttctccggcgagacgctgaaataccgcaacacgccactgatcgatgacctg
ttcatcgaccagtacacgcaggcggccgcccaatcgaaagccttcggcctgctgcgccgg
gacgtggacctcaccggctggttcgacacaagctatctgaacacggccctcaaggagctg
aagctcgaaggctactggacgccctacggcgccgacggcaagccgcttgggagctga

DBGET integrated database retrieval system