KEGG   Azorhizobium caulinodans: AZC_3178Help
Entry
AZC_3178          CDS       T00609                                 

Definition
(GenBank) conserved hypothetical protein
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: BAF89176
RhizoBase: AZC_3178
UniProt: A8IC94
Position
3633820..3635193
Genome map
AA seq 457 aa AA seqDB search
MSPRRELRLNTFQMAAPSHNWAGLWSHPRDNQTQYNTLAYWTEMAKTAERGLLDGIFIAD
VFGLYDVYGGSGDAAIAAGAQAPNADPTLAISAMALVTQHIGFGVTANLTYEHPFQFARR
FTTLDHLTGGRLGWNIVTGYLDSGARGMGESLNRDHDERYEAAEDFMAAIYKLWEGSWED
DAALRDKARGLFTDPAKVHRILHDGAYYKVDGRALAEPSPQRTPVLYQAGTSARGRVFCG
RHAEATFLNGQTPSIAGQAVRGVREAAVAAGRGPRDVLTFLGGTVIVAKTSAEAHELKEE
YRRHINAAGQLALVSGWTGVDLSQLSLDDALSFSKSNAIQSTLENLTLKAKAPTRVRDLL
DFTPAGARAPIFVGSPVEVADQMLAWADEADVDGFNLVRTVMPESLEAIVDLLIPELQNR
GAFKTAYREGTLREKLGGTARLPDSHPGAAYRHRSAP
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccccgccgtgaactgcgcctcaacaccttccagatggccgcgccctcgcacaat
tgggcggggctctggagccatccgcgggacaaccagacgcagtacaacaccctcgcttat
tggaccgagatggcgaagaccgccgagcgcggcctgcttgacggcattttcatcgcggac
gtgttcggcctctatgacgtctatggcggctccggagacgccgcgatcgccgccggcgcg
caggcgcccaatgccgacccgactctcgccatctccgccatggcgctggtgacgcagcac
atcggcttcggcgtcaccgccaatctcacctatgagcatcccttccagttcgcccgccgc
ttcaccaccctcgaccacctcacaggcgggaggctcggctggaacatcgtcaccggctat
ctcgacagcggcgcgcgcggcatgggcgagagcctgaaccgcgaccatgacgagcgctac
gaggcggccgaggatttcatggccgccatctacaagctctgggaaggctcgtgggaggat
gacgccgcccttcgcgacaaggcgcggggcctcttcaccgacccggccaaggtccaccgc
attctccatgacggggcctattacaaggtggacggccgggcgctggccgaaccctctccc
cagcgcacgcccgtgctctatcaggcgggcacctccgcgcggggacgggtgttctgcggt
cgccatgcggaggcgaccttcttgaatggccagacgccgtccattgccggccaggcggtg
cggggcgtgcgcgaggctgcggtggccgccgggcgcggcccgcgcgacgtgctcaccttc
ctcggtggcacggtcatcgtggctaagacctccgccgaggcccatgagctgaaggaagag
taccgacgccacatcaacgccgccgggcagttggcgctggtttccggctggaccggcgtt
gacctctcccagctttcgctggacgatgcgctgagcttttccaagagcaacgccatccag
tccacgctggaaaacctcaccctcaaggccaaggcgccaacccgcgtgcgcgacctgctg
gacttcacccccgccggcgcccgcgcgcccatcttcgtcggctctccagtggaggtcgcg
gaccagatgctggcctgggcggatgaagcggacgtggacggcttcaatctcgtgcgcacc
gtcatgccggaatcgctggaagccatcgtcgatctgctgattccggaattgcagaaccgg
ggggctttcaagaccgcctatcgcgaggggacgctgcgggaaaagctcggcggcacggcc
cgcctgcccgacagtcatccgggcgccgcctaccggcaccggagcgcgccctga

DBGET integrated database retrieval system