KEGG   Azorhizobium caulinodans: AZC_3180Help
Entry
AZC_3180          CDS       T00609                                 

Definition
(GenBank) nitrilotriacetate monooxygenase component A
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: BAF89178
RhizoBase: AZC_3180
UniProt: A8IC98
Position
complement(3635973..3637511)
Genome map
AA seq 512 aa AA seqDB search
MTKFIVFLSWTGWRLAEACRVGACHPAAADPVSRMRVVCLCPTRRSTARRVLSPRSRPMA
ANSESAAARRQLVLNLFIYPGGHHEAGWRYPGASAERLLDITFYQDLARSAEAAKLDAVF
FADGPALVDNIRYASRFRLEPLTWLSAIAAATHHIGLIGTASTTYYEPYNLARLFASLDH
LSGGRAGWNIVTTAVPQASGNFGLSETPSHAERYARASEFVDVVTKLWDSWEDEALVVDT
ASGLFADDTKIHPIEHVGRHYRVKGALNTPRTPQGRPVYVQAGSSDDGRSFAARYAEAIF
TAHQTLPSAQAFYADIKRQAASLGRRPEHVKILPGISPYIGSTEVEAQRLYEAFNDLIQP
EYSLTQLRQITGTDFTGHDLDARVTPDAFQNAGPRAVASRYQLVLDIVTREKPTLRQLIH
RLAGARGHYVSVGTPEKIADEIQTWFEGGAADGFNVMPPWYRGGFDLFASEVVPILRKRG
LFRSEYTGKTLREHFGLPRPESLYAQTARASA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttgactaaatttatcgtctttctatcgtggacaggctggaggttggcggaagcttgccgc
gtcggtgcatgccaccccgcggcagcagaccccgtctcccgcatgcgtgtcgtttgcctt
tgcccgacccgccgttcgaccgcccgtcgtgtcctgtcccccaggagccgtcccatggct
gccaattcagagtccgccgccgcgcgccgccaactggtgctcaatctcttcatctatccg
ggtggacatcacgaggcaggctggcgctatcccggcgcgagcgccgagcgcctgctcgat
atcactttctatcaggacctcgcccgctcggcggaggcggccaagctcgatgcggtcttc
ttcgccgatggcccggcgctggtggacaacatccgctatgcctcgcgcttccggctggag
ccgctgacctggctctcggccatcgccgccgccacgcatcatatcggcctcatcggcacc
gcctcgaccacttattacgagccctacaacctcgcccggctcttcgcttcgctggaccat
ctgagcggcgggcgcgcgggctggaacatcgtcaccaccgccgtgccgcaggcgagcggc
aatttcggcctctcggagacgccctcccatgccgagcgctatgcccgcgcctcggaattc
gtcgatgtggtgacgaagctctgggacagctgggaggacgaggcactggtggtcgatacg
gcctccggcctgtttgccgacgacacgaagatccatcccatcgagcatgtgggtcggcat
taccgcgtgaagggggcgctcaacacgccgcgcacgccgcagggccgcccggtctatgtg
caggcgggctcctccgatgacggccgctccttcgccgcccgctatgcggaggcgatcttc
accgcgcaccagacattgccgagcgcgcaggccttttatgccgacatcaagcggcaggcg
gcttcgctcggccgtcggcccgagcatgtgaagatcctgccgggcatcagcccctatatc
ggctccacggaggtggaggcgcagcggctttacgaggccttcaacgacctcatccagccg
gaatattccctcacccagcttcgccagatcaccggcaccgacttcaccggccacgatctc
gatgcgcgcgtcacgccggacgccttccagaatgccggaccgcgggcggtggcgagccgg
tatcagctcgtgctcgacatcgttacgcgcgagaagcccaccctgcgccagctcatccat
cgcctcgccggcgcgcgggggcattatgtgtcagtgggcacgccggagaagatcgcggac
gagatccagacctggttcgagggtggcgccgcagatggcttcaacgtgatgccgccctgg
tatcgcggcggcttcgacctgttcgcgtccgaagtggtgccgatcctgcgcaagcgcggt
ctgttccgcagtgaatacaccggaaagacgctgcgcgagcacttcggcctgccccggccg
gagagcctctatgcgcagacggcccgggcgtcggcctga

DBGET integrated database retrieval system