KEGG   Azorhizobium caulinodans: AZC_3182Help
Entry
AZC_3182          CDS       T00609                                 

Definition
(GenBank) tRNA/rRNA cytosine-C5-methylase
  KO
K03500  16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
azc  Azorhizobium caulinodans
Brite
Enzymes [BR:azc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.176  16S rRNA (cytosine967-C5)-methyltransferase
     AZC_3182
Ribosome biogenesis [BR:azc03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    AZC_3182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltr_RsmB-F Ubie_methyltran Methyltransf_31 Methyltransf_25 FtsJ MTS Methyltransf_11 Methyltransf_3 Methyltr_RsmF_N Methyltransf_24 GCD14 Methyltransf_15 PCMT Methyltransf_32 PrmA Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: BAF89180
RhizoBase: AZC_3182
UniProt: A8ICA4
Position
complement(3639688..3641031)
Genome map
AA seq 447 aa AA seqDB search
MPHVSQPDVRSVTPAARLQAILDLMQEVDSVDRPADAVISAWFRARRDVGAEDRGPISET
YYALLRAHARLGWWLARHGREDTPRNRLLAFLVLDGKKTRDEVARLFSGGMSAPAPLTDN
ERALLVKLQGGRMDSPSMPEEVRLECPAWALEPFRNRFGAEFEREMAALLTPAPLDLRVN
PIKAKREDMVQALRELGLPAEPSVSAPFGIRVRERPSLSRLTMLKSGEVEIQDEGSQLVA
LLMDARPGERVVDFCAGAGGKTLAIAAQMANRGHVIACDVMEGRLKRGAERFRRAGLHNI
ETRLLASETDRWVKRHKGTFDRVLVDAPCSGTGTWRRNPDARWRTLGAGLETLLPQQARI
LASAARLVKPGGRLVYATCSMLPDENEGQVASFLAAHPDFRVLPLTEVAPQLPPSAHPDY
LSLTPARHDMDGFFAAVLQRAPLPPAA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcatgtttctcagcctgatgttcgctccgtgacccctgccgcccgcctgcaagcc
atcctcgatctgatgcaagaggtcgacagcgtcgaccgacccgccgatgccgtcatctcc
gcctggttccgcgcgcggcgcgacgtgggcgccgaggaccggggtccgatttccgaaacc
tattatgccctgctgcgcgcccatgcgcggctgggctggtggctcgcccggcatgggcgg
gaggacacgccgcgcaaccggctgctggccttcctcgtgctcgacggcaagaagacgcgc
gatgaggtcgcgcgcctgttctcgggcgggatgtccgcccccgcgccgctcacagacaat
gaacgggcgctgctggtgaaactgcagggcggccgcatggatagtccctccatgccggag
gaggtgcgcctcgaatgccccgcctgggcgctggagcccttccggaaccggttcggcgcg
gagttcgagcgggaaatggcggcgctgctgacgcccgcacccctcgacctgcgcgtcaat
cccatcaaggccaagcgcgaggacatggtgcaggccctgcgcgagctgggcctgccggcc
gagccgtcggtgagcgcgccctttggaatccgcgtgcgtgagcggccgtcgctgtcgcgc
ctcaccatgctgaaaagcggcgaggtggaaatccaggacgagggctcgcagctcgtcgcc
ttgctgatggatgcccggcccggtgagcgggtggtggacttctgcgccggagccgggggc
aagacgctggcgattgccgcccagatggccaacaggggccatgtgatcgcctgcgatgtc
atggaagggcgcctgaagcgcggcgccgaacgcttccgacgggccggcctgcacaatatc
gagacgcggctgctggcgagcgagaccgaccgctgggtgaagcgccacaagggcacgttc
gaccgtgtgctggtggatgcgccgtgcagcggcacgggcacgtggcggcgcaatcccgat
gcccgctggcgcacgctgggggcggggctggagacgctgctgccgcagcaggcccgcatt
ctggcgagcgcggcgcggctggtgaagcccggcgggcggctcgtctatgccacctgctcc
atgctgccggacgagaatgaggggcaggtggcgagcttccttgcagcgcatcccgacttc
cgcgtcctgccgctcaccgaggtggcgccgcagctgccgccctcggcccatcccgactat
ctctcgctcacgcccgcgcggcacgatatggacggcttcttcgccgccgtcctccagcgc
gcgccgctgccgccggccgcctga

DBGET integrated database retrieval system