KEGG   Azorhizobium caulinodans: AZC_3183Help
Entry
AZC_3183          CDS       T00609                                 

Gene name
marR
Definition
(GenBank) regulatory protein
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 MarR HTH_27 HTH_IclR RP-C HTH_34 HTH_24 HxlR RPA_C
Motif
Other DBs
NCBI-ProteinID: BAF89181
RhizoBase: AZC_3183
UniProt: A8ICA7
Position
complement(3641089..3641604)
Genome map
AA seq 171 aa AA seqDB search
MTEPMPEDFEALVRDEPAGSKMELRLWLRLLSVSNLVSAEIRRRLRAEFDVTLPRFDVLA
QLNREPDGLRLGDLSRRMMVSNGNITGLIDRLVEEGLVVRKVDPNDRRAATVRLSRAGAT
MFRIMASAHEAWIHELFGDLSKRQVAGLLDELETLKRSVAGVVHATEADRS
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcccatgcccgaggactttgaggcgctggtgcgcgacgagccggccggctcg
aagatggagctgcgcctctggctgcggctgctctcggtgtcgaacctcgtcagcgccgag
atccgccgccggctgcgagcggagttcgacgtgacattgccccgcttcgacgtccttgcg
cagttgaaccgcgagccggacgggcttcgcctgggcgacctgtcccggcggatgatggtc
tccaacggcaacatcaccggcctcatcgaccgtctcgtggaagaggggctggtggtgcgc
aaggtggaccccaacgaccgccgcgccgcgaccgtccggctgagccgcgccggtgcaacc
atgttccgcatcatggcgagcgcccacgaggcctggattcatgaactgttcggcgatttg
tccaagcggcaggttgcggggctgctggacgaactcgagaccctgaaacgctcggtcgcc
ggggtcgtccacgccacggaggcggaccgctcctga

DBGET integrated database retrieval system