KEGG   Azorhizobium caulinodans: AZC_3188Help
Entry
AZC_3188          CDS       T00609                                 

Definition
(GenBank) putative enoyl-CoA hydratase
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 APOBEC_C
Motif
Other DBs
NCBI-ProteinID: BAF89186
RhizoBase: AZC_3188
UniProt: A8ICB9
Position
complement(3645870..3646721)
Genome map
AA seq 283 aa AA seqDB search
MSETRSTMAAMKRPFKDHRATHFSFETSADGRVATVRLNRPERKNPLTFESYAELRDLFR
DLVYASDVRAIVLAGAGGNFSSGGDVFEIIEPLTRMAMPDLLAFTRMTGDLVKAMRRCPQ
PIVAAVDGVCAGAGAILAMASDLRLATPEAKTAFLFARVGLAGADMGACGILPRVIGQGR
AAELLFTGRAMTAAEGAAWGFYNALHPAADMEAKAQELARSLADGPWFAHGMTKTMLNQE
WAMGLEELIEAEAQAQAICMATQDFRRAFEAFAAKAKPAFEGN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacccgatccacgatggcggccatgaagcgtccgttcaaggaccaccgcgcc
acccatttcagcttcgagacgagcgccgatggccgtgtcgcgaccgtccgcctcaaccgg
ccggagcgcaagaacccgctgaccttcgagagctatgccgagttgcgcgacctgttccgc
gatctcgtctatgcctcggatgtgcgggccatcgtgctcgccggggccgggggcaatttc
tcctcgggcggcgatgtgttcgagatcatcgagccgctcacccgcatggccatgcccgat
ctccttgccttcacgcggatgaccggcgatctcgtgaaggccatgcggcgctgcccgcag
cccatcgttgccgccgtcgacggcgtctgcgccggcgccggcgcgatcctcgccatggcc
tccgacctgcggctggcgacgcccgaggccaagacggcctttctctttgcccgcgtgggc
cttgccggcgctgacatgggggcgtgcgggatcctgccgcgcgtcatcgggcaggggcgg
gcggctgagctgctgttcaccggccgcgccatgaccgccgccgagggggcggcgtggggc
ttctacaacgccctccatccggccgcggacatggaggcgaaggcgcaggaactcgcccgc
tcgctggcggacggcccatggttcgcccatggcatgaccaagaccatgctaaatcaggaa
tgggccatgggccttgaagaactgatcgaggcggaagcgcaggcgcaggccatctgcatg
gcgacgcaggacttccgccgcgccttcgaggcttttgccgccaaggcgaaacccgctttc
gaggggaactga

DBGET integrated database retrieval system