KEGG   Azorhizobium caulinodans: AZC_3193Help
Entry
AZC_3193          CDS       T00609                                 

Definition
(GenBank) ABC transporter permease protein
  KO
K01998  branched-chain amino acid transport system permease protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc02010  ABC transporters
azc02024  Quorum sensing
Module
azc_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AZC_3193
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AZC_3193
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3193
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    AZC_3193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: BAF89191
RhizoBase: AZC_3193
UniProt: A8ICD2
Position
3652401..3653345
Genome map
AA seq 314 aa AA seqDB search
MMTVPSFVKNPALATVAAFLLLLALAHGLGFSHGATLVTRTLAYALAAVSLSFLIGQCGL
VSFGHAAPFGIGAYAVLIAGEAGVREVLVVLPLAAAAAALFSAVTGAIALRTRGVYFIMI
TLAFAQMAFYVAASLSAYGGDDGMAIAGRSTFFGIRFLKADTSLALLAIALVGLALFLFQ
RLAASRFGLMLRAARANESKVEALGLAPYRHRLIALALAGAVAGLAGALIANQVEYVSPA
LMGWHVSGELIVMVVLGGIGHPVGAVIGAVVVTLLDESLGHLTEHWRLGLGLVIILVALL
RDADLKSLLRGGSR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgatgacggtcccgtctttcgtgaaaaacccggcactggcgaccgtcgcggccttcctt
ctgctcctcgctctcgcccatgggctcggcttctcccatggcgcaacgctggtcacccgg
acgctggcctatgccctcgcggccgtctccctgtcctttctgatcggccagtgcggcctc
gtgagcttcggccatgccgctccgttcgggatcggcgcctatgccgtgctcatcgccggt
gaggcgggcgtccgcgaggttctcgtggtgctgccgcttgccgcggcggcggcggcgctg
ttctcggcggtcaccggcgccatcgcgctgcgcacgcgcggcgtctatttcatcatgatc
acgctcgccttcgcgcagatggccttctatgtcgcggcgagcctgtccgcttacggcggc
gacgacggcatggccatcgccgggcgctcgaccttcttcggcatccgctttctgaaggcc
gatacgtcgttggcgctcctcgccattgcgctcgtcggcctcgccctcttcctgttccag
cggcttgcggcctcgcgcttcggcctcatgctccgtgccgcccgggcgaacgagagcaag
gtggaggcccttggccttgcgccctaccgccaccggctgatcgccctcgcgctcgccggc
gcggtggcggggctggccggcgcactgatcgccaaccaggtggaatatgtctcccccgcc
cttatgggctggcacgtctcgggcgagctgatcgtgatggtggtgctgggcggcatcggg
catccggtgggcgccgtcatcggcgcggtggtggtgacgctgctggacgaaagcctcggc
cacctcacggagcactggcggctgggcctcggcctcgtcatcatcctcgtggcgcttctg
cgcgatgccgatctgaagtccctgttgcgcggagggtcccgatga

DBGET integrated database retrieval system