KEGG   Azorhizobium caulinodans: AZC_3194Help
Entry
AZC_3194          CDS       T00609                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc02010  ABC transporters
azc02024  Quorum sensing
Module
azc_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AZC_3194
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AZC_3194
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3194
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    AZC_3194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 BCA_ABC_TP_C AAA_29 AAA_25 AAA_23 AAA SRP54 MukB AAA_16 RsgA_GTPase AAA_27 AAA_30 SMC_N AAA_33 AAA_22 AAA_28 AAA_24 NACHT TsaE AAA_14 NB-ARC AAA_15
Motif
Other DBs
NCBI-ProteinID: BAF89192
RhizoBase: AZC_3194
UniProt: A8ICD4
Position
3653342..3654097
Genome map
AA seq 251 aa AA seqDB search
MSTPILALEGLMKSYGAMQVTRDVSLDVRPGEVHALIGPNGAGKTTLIAQIAGSITPNAG
RIRFDGADVTDIGIAARARRGLGRVFQISNVVGSFTALENVAVAAIAAGDGPFRFWRRAL
ADRKLTARAESALERVGLGNRRLTLARDMSHGERRALELAMSLVQEPKLLLLDEPMAGTG
RAEGERLTELLLSLKGRIPILLVEHDMATVFRLADRISVLIYGAIAVTGDPATVRTDPLV
RQAYLGEEEAV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccatcctcgcgctcgaaggcctcatgaaatcctacggcgccatgcaggtg
acgcgggatgtctccctcgacgtccgccccggcgaggtgcacgcgctgatcggcccgaac
ggcgccggcaagaccacgctgatcgcgcagatcgcaggttccatcacaccgaatgcggga
cgcatccgcttcgacggtgccgatgtcacggacatcggcatcgccgcccgtgcccggcgc
gggctggggcgggtgttccagatctccaatgtggtcggctcgttcaccgctctggaaaac
gtcgcggtcgcggccatcgcggcgggcgacgggcccttccgcttctggcggcgggcgctg
gccgaccggaagctgacagcccgtgccgaatccgctttggagcgggtcgggctcggcaac
cgtcgcctaacccttgcgcgcgacatgtcccatggcgaacggcgggcgcttgaacttgcc
atgagcctcgtgcaggagcccaagctcctgctgctcgacgagcccatggccggcacgggc
cgcgcggaaggcgagcggctgaccgaactgcttctgtccctgaagggacgcattcccatc
ctgctggtggaacacgacatggcgacggtgttccgtctggcggaccgcatctccgtcctg
atctacggtgccatcgcggtcacgggcgacccggccacggtgcgcaccgatccgctggtg
cggcaggcctatctcggcgaggaggaggcggtctga

DBGET integrated database retrieval system