KEGG   Azorhizobium caulinodans: AZC_3198Help
Entry
AZC_3198          CDS       T00609                                 

Gene name
iclR
Definition
(GenBank) putative transcriptional regulator
  KO
K13641  IclR family transcriptional regulator, acetate operon repressor
Organism
azc  Azorhizobium caulinodans
Brite
KEGG Orthology (KO) [BR:azc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:azc03000]
    AZC_3198 (iclR)
Transcription factors [BR:azc03000]
 Prokaryotic Type
  Helix-turn-helix
   IclR family
    AZC_3198 (iclR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IclR HTH_IclR MarR_2 HTH_24 MarR HTH_20 HTH_10 Rrf2
Motif
Other DBs
NCBI-ProteinID: BAF89196
RhizoBase: AZC_3198
UniProt: A8ICE5
Position
3656383..3657279
Genome map
AA seq 298 aa AA seqDB search
MRFQPRPACRIVPGRRFASERPGHDGIGQSMGRRIAGARPAGEDKSEGLVRAVDRALGLL
ERVSDAPRGIALAQLAAEADLAASTAHRLLSTLEDRGFVRFERASGRWFIGRTALAVGAG
YAGSRDMVACAQPILKRLGQACGETVNLGMLDEGKVVFLHRFEARTRRAFVPSGTSLPAH
CSSIGKALLSVLPFAEVREAVSADRLVPVTAKTMCSRDVFMSALEETRRAGFALDDEENT
PGLRCIAAPVFDAYHRPVAAVSLAAPVERLELGQVAECGRKVAAAARELTQAWSGARL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcttccagccccgcccggcctgtcgcatcgtacccgggcgccgcttcgcatcggag
cggccggggcatgacgggataggccagagcatgggccgcaggattgcgggcgcccgtcct
gcgggcgaggacaagagcgaggggctggtgcgcgccgtggatcgggcgctcggccttctt
gaacgggtcagcgatgccccgcgcggcatcgcgctggcgcagctcgccgccgaggcggat
cttgccgcctccaccgcccatcggctgctgtccaccctcgaggatcgcggcttcgttcgc
ttcgagcgcgccagcggccggtggttcatcggccgcacggcactcgcggtcggcgccggc
tatgccggctcgcgggacatggtggcctgcgcccagccgatcctgaagcgcctcggacag
gcctgcggcgagacggtcaacctcggcatgctggacgagggcaaggtcgtcttcctgcat
cgcttcgaggcacgcacgcggcgggccttcgtgccgtccggcacctccctgcccgcgcat
tgctccagcatcggcaaggccctgctctccgtgctgcctttcgccgaggtgcgggaggcc
gtgtccgccgatcgtctggtgcccgtcacggccaagacgatgtgctcgcgcgacgtcttc
atgagcgcgctggaagaaacgcggcgggcgggcttcgccctcgatgacgaggagaacacg
cccggcctgcgctgtatcgcggccccggtgttcgacgcctatcaccgccccgtggcggcg
gtttccctcgccgcgccggtggagcgcctagaacttgggcaggttgccgaatgcggacgc
aaggtcgccgccgcagcccgtgaactcacgcaggcctggtccggcgcgcgcctctga

DBGET integrated database retrieval system