KEGG   Azorhizobium caulinodans: AZC_3201Help
Entry
AZC_3201          CDS       T00609                                 

Definition
(GenBank) ABC transporter permease 1
  KO
K02057  simple sugar transport system permease protein
Organism
azc  Azorhizobium caulinodans
Module
azc_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3201
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    AZC_3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 FUSC-like
Motif
Other DBs
NCBI-ProteinID: BAF89199
RhizoBase: AZC_3201
UniProt: A8ICF3
Position
3660103..3661203
Genome map
AA seq 366 aa AA seqDB search
MLDRAPMTTEAPIRPVTAFRLRALLAGDGVRTVALTLGAIALALLVTAGLIALAGKNPIV
AYGALLRGAFGSVDRFAFALNKSTPYILAGVGVALCFRAKVINIGGEGQIAVGGIGASLV
LLLAPAGLPPVLLLPLAMLAGAAFGALWAILAAWVFIKRNVHEVLCTLLLNFVGVLLVSE
VLRAPLGEEGAGFPQSPLFPRAGWLPKLIPGTDLHMGILLAVAAVVLGHVLLWRTTFGFR
LRVMGASRPAAAYVGLSTARSTFAVMAIAGALAGLAGGIEVSGVHNRLIEGFSHGFGFNA
VAVALIAGLNPLAILPAGLFLGFLEAGALAMQREIGVPSSLVYVIEGLMMVFVLCAVGLN
ARNRRV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgctggaccgcgcgccaatgacgaccgaagcccctatccgccccgtgactgccttccgt
ctgcgcgcgctccttgccggtgacggcgtgcgcaccgtcgcgctgacgctcggtgccatc
gcgctcgctctgctcgtcaccgccgggctgatcgcgctcgcgggcaagaaccccatcgtc
gcctatggcgcgctgttgcgcggcgcattcggctccgtggaccgcttcgccttcgccctc
aacaagagcacgccctacatcctcgcgggcgtgggggttgccctgtgcttccgcgccaag
gtcatcaacatcggcggcgaaggccagattgcggtgggcggcatcggcgcgagcctcgtg
ctcctgctcgcccccgccggcctgccgccggtcctcctgctccccctcgccatgctggcg
ggtgccgccttcggcgcgctctgggccattctggccgcatgggtgttcatcaagcgcaac
gtgcatgaggtgctgtgcacgctgctgctcaatttcgtcggcgtgcttctggtgagcgag
gtgctgcgcgccccgctgggcgaggagggcgcgggctttccgcagtccccgcttttcccg
cgtgccggctggctgcccaagctcatccccggcacggacctgcacatgggcatcctgctg
gcggtggcggcggtcgtccttggccatgtgctgctctggcgcaccaccttcggcttccgg
ctgcgcgtcatgggcgcgagccgcccggcggcggcctatgtgggcctgtccaccgcccgc
agcaccttcgcggtgatggccatcgccggcgcgctggccggccttgcgggcggcatcgag
gtcagcggcgtgcacaaccgcctgatcgaaggcttctcccacggcttcggcttcaatgcg
gtggcggtcgccctcatcgccgggctcaatccgctggccatcctgcccgccgggctgttc
ctcggcttcctggaagccggtgcgctggccatgcagcgggagatcggcgtgccctcctcg
ctcgtctatgtgatcgaggggctgatgatggtcttcgtgctctgcgcggtgggcctcaat
gcccgcaaccggagggtctga

DBGET integrated database retrieval system