KEGG   Azorhizobium caulinodans: AZC_3205Help
Entry
AZC_3205          CDS       T00609                                 

Definition
(GenBank) putative membrane-fusion protein
  KO
K02022  HlyD family secretion protein
Organism
azc  Azorhizobium caulinodans
Brite
KEGG Orthology (KO) [BR:azc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    AZC_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 Biotin_lipoyl Biotin_lipoyl_2 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: BAF89203
RhizoBase: AZC_3205
UniProt: A8ICG3
Position
3664682..3666013
Genome map
AA seq 443 aa AA seqDB search
MPFARASRTNAGNLEHPRLAPMSAPAPAFRNTSPDQLDLMVRVSSPMGWLVLAVFICVVL
GGLAWSILGTAPIKVAGTGVLQGTGGVLLVSSPGNGPVSDLKVAVGAQVHAGEIVAVLSD
PVLDARAQTITARLAQLQEEQRKLAAFQAREKEVRARADAQRKEALENTIRQAREREAAL
TQVLANQRDLLSRGLATRDRVLITENDREQARRDAADAANAINALGVEADERGIRAERDM
LDLSARLSQSRQELAEVEAERAARTLVRAPGDGRIIELSVALGDRVSAGSSLMRLVPEVR
GAAGEGLVGILYVPSSEGKKVRPGMPVQVVPSTVNMERDGFIRGEVIRVSETPATREAVQ
QTLKNEAFVARLLANGPPFEVQVALKRDPSSVSGFAWSSELGATRPVEAGTVVSGSVVVE
RVRIITLVFPAFERLFHALGGGR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgccttttgcgcgcgcctcgcgcaccaatgccgggaatctggaacatccaagactggcc
ccgatgagcgctccggccccggccttccgcaatacgagcccggatcagctcgacctcatg
gtccgcgtgtcttcgcccatgggctggctggtgctggcggtgttcatctgcgtggtgctc
ggcggacttgcctggtcgatcctcggcacggcgccgatcaaggtggcgggcacaggcgtg
cttcagggcacaggcggcgtcctgctcgtgtcgtcgccgggcaacgggccggtctcggac
ctcaaggtggccgtgggggcgcaggtgcatgccggcgagatcgtcgccgtgctgtccgat
cccgtgctggacgcccgcgcccagaccatcaccgcgcgccttgcccagttgcaggaggaa
cagcgcaagctcgcagcgtttcaggcgcgcgagaaggaggtgcgcgcccgcgccgatgcc
cagcgcaaggaagcgcttgaaaacaccatccgccaggcccgcgagcgcgaggccgccctc
acccaggtgctcgccaaccagcgggatctgttgagtaggggcctcgccacccgcgaccgc
gtgctgatcaccgagaacgaccgcgagcaggcccgccgggatgcggcggatgcggccaac
gccatcaatgccctcggcgtcgaggcggacgagcgcggcatccgtgccgagcgcgatatg
ctcgatctgtccgcccgcctcagccagagccggcaggaactggcggaagtcgaggccgaa
cgggcggcacgcaccctggtgcgcgcgccgggcgatggccgcatcatcgaactgtcggtg
gcgctgggcgaccgggtgagcgccggcagcagcctcatgcgcctcgtccccgaagtgcgg
ggcgcagcgggcgagggcctcgtgggcatcctttatgtgccctccagcgagggcaagaag
gtgcggcccggcatgccggtgcaggtggtgccctccaccgtgaacatggagcgcgacggc
ttcatccggggcgaggtcatccgcgtgtccgagacgccggcgacccgcgaggcggtgcag
cagaccctgaagaacgaggccttcgtcgcccgcctgctcgccaatggcccgcccttcgaa
gtgcaggtggccttgaagcgggatccctcgagcgtcagcggctttgcctggtcctccgag
cttggcgccacgcggccggtggaagcgggcacggtggtctccggcagcgtggtggtggag
cgcgtgcgcatcatcaccctggtcttcccggccttcgagcgcctgttccacgccctcggg
ggcggccggtga

DBGET integrated database retrieval system