KEGG   Azorhizobium caulinodans: AZC_3214Help
Entry
AZC_3214          CDS       T00609                                 

Definition
(GenBank) hypothetical protein
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4434
Motif
Other DBs
NCBI-ProteinID: BAF89212
RhizoBase: AZC_3214
UniProt: A8ICI7
Position
complement(3679212..3680219)
Genome map
AA seq 335 aa AA seqDB search
MLIPSFNPGLSSPTRRGLMWVVAGCGVLALTSSGPFQRWLPRRLDGTFLQAWKSDLDLPR
SAWAERIHLFATLDCRHLILQWVSFGQEYGLSDPLLLDILDFALAAGVRVTFGLPYDGGY
WQMLASGDRAKRAAFLDRVGTEGVAFLEAARHSNHPAFAGYYIPYEIDQYSWADPADRDL
LAGYLRRISAAARGPGVLSISTFRSGIPTTATLEGLWERILTSVPLKLMVQDGVGVFGMA
NYARLAPLFATLRRRGADFDVIVELFTEKPSGRTDGTTFAADPATIGRLQAQLAVAAGTG
ARRLIGFAVHPYMTDGMPGAADLRRSYLRALSAGA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctgattccatcatttaatccgggcctgagttctcccacccgccgcgggctgatgtgg
gtggtagcgggatgtggcgtgctcgccctgacttcgtcgggcccttttcagcgctggctg
ccgcgccggctggacggcacgtttctccaggcatggaagagtgacctcgatcttccgcgc
agcgcgtgggcagagcgcatccacctgttcgcgaccctggattgccgccatctcatcctg
cagtgggtctccttcggccaggaatacggcctgtccgatccgctgctgctggatattctc
gactttgccctggcggccggggtgcgggtgacgttcggcctgccttatgatgggggatac
tggcagatgctggcctccggcgatcgggcaaagcgcgcggcctttctcgatcgcgtcgga
acggagggcgtggcgttccttgaggccgcgcgccattccaaccatcccgctttcgccggc
tactacattccctacgaaatcgaccagtacagctgggccgatcctgcggaccgcgatctc
ctcgctggctatctgcgccggatcagcgccgccgcgcgggggccgggcgtgctgtccatc
tccacctttcgcagtggcattccaacgacggcgacgcttgagggactttgggagcgcatt
ctgacgtccgtgcccctgaagctgatggtgcaggatggggtgggtgtcttcggcatggcg
aattatgcccgcctcgccccgctgtttgcgacgttgcgccgtcgaggcgctgatttcgat
gtgatcgtggagctgttcacggagaagccttccggccgcacggatggcacgaccttcgcg
gcagatccggccacgatcggacggctgcaggcgcagctcgcggttgccgccggaaccggt
gcgcggcgtctcatcggcttcgccgtccatccctacatgaccgatggtatgcctggagcg
gccgacctgcggcgcagctatctgcgagcgctgtccgcgggcgcatga

DBGET integrated database retrieval system