KEGG   Azorhizobium caulinodans: AZC_3215Help
Entry
AZC_3215          CDS       T00609                                 

Definition
(GenBank) UDP-N-acetylglucosamine 2-epimerase
  KO
K01791  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing) [EC:5.1.3.14]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00520  Amino sugar and nucleotide sugar metabolism
azc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_3215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:azc01005]
    AZC_3215
Enzymes [BR:azc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.14  UDP-N-acetylglucosamine 2-epimerase (non-hydrolysing)
     AZC_3215
Lipopolysaccharide biosynthesis proteins [BR:azc01005]
 Unusual sugar
  AZC_3215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase_2 Glyco_transf_4 YAcAr
Motif
Other DBs
NCBI-ProteinID: BAF89213
RhizoBase: AZC_3215
UniProt: A8ICI9
Position
3680330..3681496
Genome map
AA seq 388 aa AA seqDB search
MKVMSIFGTRPEAIKMAPLVRAIEASADLSGLVCVTGQHRAMLDQVLSFFGIVPDIDLDV
MVPNQTLNGLMSRVLARLDEALATHRPDYVLVHGDTTTALAATLAAFHRGIPVGHVEAGL
RTYDLTQPWPEEMNRQVVDRMARDLFSPTEQSAAHLRDERAPGRIFVTGNTVIDALLMTL
GRIDADAELKATLDRQFSFLDPGRRLVLVTGHRRENFGEGFAQICEALAALAQRQDIEIV
YPVHLNPNVRGPVHERLSGKPNLHLIAPLDYVPFVALMRRANVILTDSGGVQEEAPSLGK
PVLVMRDVTERPEAVAAGTVELVGTDAARIVAHVTRILDRADSPSASAARINPYGDGGAS
RRIVDVLCGRIPLPFHDRAAQRPARMRR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgatgagcatattcgggacgcggcctgaagccatcaagatggcgccgctcgtc
cgagccatcgaggcgtctgcggatctgtcgggactggtgtgcgtgacgggacagcatcgc
gcgatgctggatcaggtgctgtcttttttcggcatcgtgccggacatcgatctcgacgtg
atggtccccaaccagacactcaatgggctcatgtcccgtgtgctggcacgccttgacgag
gccctggccacccaccgccccgattatgtgctggttcatggcgataccacgaccgcgctc
gcggccacgcttgctgcctttcatcggggcattcccgtgggccatgtggaagccggcctg
cgcacctacgacctcacccagccctggccggaggaaatgaaccgtcaggtggtggaccgc
atggcccgcgacctcttcagccccaccgagcagtccgccgcgcatctgcgcgacgaacgg
gcaccagggcggattttcgttaccggcaatacggtcatcgacgcgctgctgatgacgctc
ggccgcatcgatgcggatgcggaactgaaagccaccctcgaccggcagttctccttcctg
gaccccggtcgacgcctcgtgctggtgacgggacaccggcgggagaatttcggcgaaggt
tttgcccagatctgcgaagcgctggccgcgctcgcgcagaggcaggacatcgagatcgtc
taccctgtccacctcaatccgaatgtccgcgggccggtgcacgaacgcctttcaggaaag
ccgaacctgcacctcatcgcgccgctcgactacgtcccgttcgttgccctgatgcgtcgg
gcgaacgtcatcctcaccgattccggcggcgtgcaggaggaggccccgtccctcggcaag
ccggtcctcgtgatgcgggacgtgaccgagcgccccgaggccgtcgcggcgggcacggtg
gaacttgtggggaccgacgccgcccgcatcgtcgcgcatgtcacccgcattctcgatcgt
gccgacagtccgtcggcttcggctgcgcgcatcaacccctatggcgacggcggcgccagc
cgtcgcatcgtggacgtgttgtgcggacgcattccgctccctttccatgaccgtgcggcg
cagcggcccgcacgcatgcggaggtaa

DBGET integrated database retrieval system