KEGG   Azorhizobium caulinodans: AZC_3217Help
Entry
AZC_3217          CDS       T00609                                 

Definition
(GenBank) bacteriophage N4 adsorption protein B
  KO
K11740  bacteriophage N4 adsorption protein B
Organism
azc  Azorhizobium caulinodans
Brite
KEGG Orthology (KO) [BR:azc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AZC_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_2_3 Glyco_tranf_2_3 T2SSE_N Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: BAF89215
RhizoBase: AZC_3217
UniProt: A8ICJ4
Position
3683824..3685941
Genome map
AA seq 705 aa AA seqDB search
MQYFLTYGGAEYYVVLEWVAAATAIVIAISSLDDLFIDAYFWIREGYRRLTVKRLFQPLT
PEQLVEKDQQPFAIMIPAWRESEVIAVMLETMVASLNYRDYVIFVGTYPNDPETITEVER
MRRRYKQLQRVELPHNGPTSKADCLNWVIQAIFHYEELHQTEFAGVVLHDSEDVLHPLEL
YLFNYLLPRKDLVQLPVVSLERNWYELVAATYMDEFAEWHGKDLPVRESISGMVPSAGVG
TGFSRHALLALCAENGGRPFNVDSLTEDYDIGLRLSRLGMKSIFVRFPVQYEVRRRSMFG
NERVTTLEMPLCVREFFPDNFRAAYRQKARWTLGIALQSWRQIGWPGSLATKYLLFRDRK
SLVTSLVGILAYVLVIHFMLFYLAALAGIWTVRFPPVFADNPWLSWVLGFNLAALFLRAI
QRAYFVSRIYGYEQGLLSLPRMVVCTAVNFMAAARAWRVFLQNAIFGAPVTWDKTAHFFP
TADQLLARRRRLGDLLLTWQVLDHGRLEEALAEQKKRDIPLGRVLMAQGWLDDETLAEAI
AVQADLPRCHLSAEDVKLHADDMPRALSVRFRTISIGPAPDGTPRIAVGGPLPAEALLEV
GNALGGVPRQFVARESEIASGLRLLSEAPDQFTTAEHGNVPLLGDVLMDHGLVKRADFEH
AIADYRPERDGRIGDFLVARGVVTREAVEAAFEEQRRQAREQVEA
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatttcctgacctacgggggcgccgaatattacgtcgtcctggaatgggtcgct
gccgcgacggcgatcgtcatcgccatctccagcctcgatgacctgttcatcgacgcctat
ttctggatccgcgaaggctatcgccggctcacggtcaagcggctgttccagccgctgacg
ccggaacagctggtggagaaggaccagcagcccttcgccatcatgattccggcctggcgg
gagtcggaggtgatcgcggtcatgctcgagaccatggtcgcgagcctcaactaccgcgac
tatgtgatcttcgtcggcacctatcccaacgacccggagacgatcacagaggtcgagcgc
atgcgccggcgctacaagcaactccagcgcgtggagctgccgcacaacggcccgaccagc
aaggcagactgcctcaactgggtgatccaggccatcttccattacgaggaactccatcag
acggagttcgccggtgtggtgctgcacgacagcgaggacgtcctgcatccgctggagctt
tatcttttcaactacctcctgccccgcaaggacctcgtccagctgcccgtagtctcgctc
gaacgcaactggtacgagctggtcgcagccacctacatggacgagttcgcggaatggcac
ggcaaggacctgccggtccgcgaaagcatctccggcatggtgccgtcggcgggcgtcggc
acgggattctcgcgccacgctctcctcgcactctgtgccgagaatggcggccgtcccttc
aacgtggacagcctgaccgaggactatgacatcggcctgcgactgtcccgtctcggcatg
aagtcgatcttcgtgcgcttcccggtgcagtacgaggttcgccgccggtccatgttcggc
aacgagcgcgtgaccacgctggagatgccgctgtgcgtgcgtgagttcttcccggataat
tttcgcgccgcctaccggcagaaggctcgctggacgctggggatcgccctgcagagctgg
cgtcagatcggatggccaggctcgctcgcgaccaaatacctgctgttccgtgaccggaaa
tcgctggtgacctcgctcgtgggcatccttgcctacgtgctcgtcatccacttcatgctg
ttctatctggcggcgctcgccggcatctggaccgtccgcttcccgccggtgtttgccgac
aatccctggctgagctgggttctgggcttcaatctggcagcgcttttcctgcgcgccatc
cagcgcgcctatttcgtctcgcgcatctatggttacgagcagggcctgctttccctgccg
cgcatggtggtctgcaccgcggtgaatttcatggccgccgcccgcgcgtggcgcgtcttc
cttcagaatgcgatcttcggcgcaccggtgacgtgggacaagaccgcccacttctttccg
accgccgaccagttgctggcccgccgccgccgtctcggcgacttgctgctgacctggcag
gtgctcgaccacgggcgcctcgaggaagccctcgcggagcagaagaagcgggacatcccg
ctgggccgcgtgctcatggcgcaaggctggctggatgacgaaacgctggcggaggcgatc
gccgtgcaggccgacctgccccgctgccacctcagcgcggaggatgtgaagctgcacgcg
gacgacatgccgcgggccctgagcgtccgcttccggaccatctcgatcggccccgcgccg
gatggcacgccccgcatcgccgtgggcggtcctctgcccgccgaagcgctgctggaggtc
ggcaatgcgctgggcggcgtaccgcggcagttcgtggcccgcgagagcgagatcgcatcc
ggccttcggctgctgtcggaggcacccgaccagttcacgacggccgaacacggaaacgtg
ccgttgctgggcgacgtgctcatggaccatgggctggtcaagcgcgccgatttcgagcat
gccatcgcggattaccgccccgagcgtgacggccgcatcggtgacttcctcgtcgcgcgc
ggcgtcgtgacacgcgaagcggtcgaggcggcattcgaggagcaacggcgtcaggcgcgc
gagcaggtggaggcgtga

DBGET integrated database retrieval system