KEGG   Azorhizobium caulinodans: AZC_3218Help
Entry
AZC_3218          CDS       T00609                                 

Definition
(GenBank) cell morphology protein
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlgF
Motif
Other DBs
NCBI-ProteinID: BAF89216
RhizoBase: AZC_3218
UniProt: A8ICJ7
Position
3685938..3686636
Genome map
AA seq 232 aa AA seqDB search
MMGQRHLEAGFAVLLAAAVMFPGLAGAQTAPLTRLYAPKPPQGSAYVRVVNPTAAAAAVS
LAGGAPVTLGPATERALAYRVAPGGKPVTLTVDGKPVAGEIVPVADGFLTIALSGGPGGW
SAKPLPDATEGRDDLKVMLRFYNLAEGCTAALAVADGPTVFDGVPQSESRQRAINPVDAS
LVGRCGPLASAPVRLPKLKAGDHYSLFLGGNATAPILQGQVDETEPYRGTAN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtgatgggccagcgacatcttgaggcggggttcgccgtgcttctggccgcggcggtgatg
tttcccggtctcgccggcgcccagacggcgccgctgacacgactctacgcgccgaaaccg
ccccaggggtcagcctacgtgcgcgtggtgaaccccaccgctgccgcggcggccgtttcc
ctcgcgggcggcgcgccggtcaccctcggtcccgccaccgaacgcgcgcttgcctatcga
gtggcacccggcggcaagcccgtgacgctcaccgtggacggcaagccggtcgccggcgag
atcgtgcccgtggcggacggcttcctcaccatcgccttgtcgggcggtccggggggatgg
agcgcaaagccgctgccggatgccacggaaggccgagacgacctcaaggtcatgctgcgc
ttctacaatctggccgagggatgcacggccgccctcgccgtcgccgacggcccgaccgtg
ttcgatggggtgccgcagagcgagagccgtcagcgcgcaatcaacccggtggacgccagc
ctcgtggggaggtgcggtcctctcgcctccgcgcccgtgcgccttccgaagctgaaggcg
ggggatcattacagcctgttcctcggcggcaacgccaccgcgccgatcctgcagggacag
gtggacgaaaccgagccctatcgcggcacggccaactga

DBGET integrated database retrieval system