KEGG   Azorhizobium caulinodans: AZC_3219Help
Entry
AZC_3219          CDS       T00609                                 

Definition
(GenBank) cellulose acetylase
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-ProteinID: BAF89217
RhizoBase: AZC_3219
UniProt: A8ICJ9
Position
3686661..3688046
Genome map
AA seq 461 aa AA seqDB search
MVFASDSFIFLFLPVFLATYALAPAAWRNLVILAFSWTFYAWWRLDFLPLIVSIAVWSWL
TGLWIAARPPERRRLPLIVAILWPLLALVWFKYANLFAETALSLGAPLTGWQAIVLPIGL
SFFVFGAISYSVDVARGTVKAEPSFINYATYQSMFGHLVAGPVVRYEWVAERLKARAFDR
DEFALGVERFMLGFAQKVLLADTLAPLVDAGFSLSNPSAADVGLSVLAYALQLYFDFAGY
SSMAIGLGLMVGLKFHENFDNPYLSFSITEFWRRWHISLSTWLRDYLYIPLGGSRTGLAR
SCVNVMITMGLGGLWHGASWTFLVWGLWHGIGLVWVRLWRAVGLPVPPVLVGHVATLLFV
LFGWLLFRAQTWAEFGVMLHGLSGANGWGLSDALGAALRPTHLLTIALGIALVYVPLAGR
ASPQLAAKGRWLTSWSALPLWLAAVWVLQGRTVVPFLYFQF
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggtctttgccagtgacagtttcatcttcctcttcctgccggtcttcctcgcgacctat
gcgctggcgcccgccgcctggcgcaatctcgtcatcctcgccttttcctggaccttctac
gcctggtggcggctcgacttcctgccgctcatcgtctccatcgcggtctggtcctggctt
accggcctgtggatcgccgcgcgtccgccggagcggcggcgcctgccgctgatcgtcgcc
atcctgtggccgctgctggcgctggtctggttcaagtacgccaacctgttcgcggagacg
gcgctctccctcggcgccccgctcaccggctggcaggccatcgtgctgcccatcggtctg
tccttcttcgtcttcggcgccatctcctattcggtggacgtagcccgcgggacggtgaag
gccgaaccctccttcatcaattacgccacctaccagtccatgttcggccacctcgttgcc
ggtccggtggtgcgctatgaatgggtggccgagcggctgaaggcgcgcgccttcgaccgg
gacgagttcgcactgggcgtcgagcgcttcatgctcgggttcgcccagaaagtgctgctg
gcggacacgctggcgccgctggtggatgcaggcttctcgctgtcgaacccatccgctgcg
gacgtcggcctctcggtcctggcctatgcgctccagctgtatttcgatttcgccggctac
agttccatggccatcggccttgggctcatggtgggcctgaaattccacgagaatttcgac
aatccatacctgtccttctccatcaccgaattctggcggcgctggcacatcagcctgtcc
acgtggctgcgcgactatctctacatccccctcggcggcagccgcaccgggctggcgcgc
tcctgcgtgaacgtcatgatcaccatgggcctcggcggcctctggcatggcgcgagctgg
acctttctcgtgtgggggctgtggcacggtatcggcctcgtgtgggtgcgcctgtggcgt
gccgtgggccttcccgtcccgccggtactcgtcggccacgtcgccaccttgctgttcgtg
ctgttcggctggctgctgttccgcgcccagacctgggccgagttcggcgtgatgcttcac
ggtctgtccggagccaacggctgggggctctccgacgcgctcggtgccgcgctgcgaccg
acgcatctgctcaccatcgcgctggggatcgcgctcgtttacgtaccgctcgccggtcgg
gcttcgccgcaattggctgctaagggacgttggctgacgtcctggtccgccctgccgctg
tggctggccgccgtctgggtgctccagggccgcacggtcgttcccttcctgtatttccag
ttctga

DBGET integrated database retrieval system