KEGG   Azorhizobium caulinodans: AZC_3224Help
Entry
AZC_3224          CDS       T00609                                 

Definition
(GenBank) putative 4-methylmuconolactone transporter
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like
Motif
Other DBs
NCBI-ProteinID: BAF89222
RhizoBase: AZC_3224
UniProt: A8ICL3
Position
3695062..3696348
Genome map
AA seq 428 aa AA seqDB search
MSSTTNAAATAADTSLTGFYRDMTLPERRTFWACATGWALDGMDFMIYPLVIGTIIKLWN
VDAGAAGLAGTVTLLASALGGWGAGYLADRIGRVRTLQFTILWFSFFSLLCAFAQNFEQL
LICRALLGIGFGGEWAAGAVLMGETIRAQYRGRAVGSVQSGWAIGWGAAVLAQAALFSLM
PAEEAWRWMFGIGALPALLVLYLRSYVKEPEVSAQTIKRGQTSGDRPSILEIFRGPILKV
TILASLVATGCQGGYYAITFWVPRFLTTERHLSIVSSTGYLAALIVGSFAGYLVGAWFSD
RFGRRSLFLVFSLGAMAVVLAYTQLPLSNEILWVLGFPLGFFASGYFSGMGAFLTELYPT
RLRGSGQGFCYNFGRGIGALFPFLVGYLSQTTSLANAICIFAMVAYVVFFLAAYGLPETR
GKVLHADA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgaccaccaatgcggccgcaacagccgcggataccagcctgaccggcttctac
agggacatgaccctgccggaacgccgcaccttctgggcctgcgccaccggctgggcgctc
gatggcatggacttcatgatctatccgctggtgattggcacaatcatcaagctgtggaac
gtggatgcaggcgccgccggcctcgccggcactgtgaccctgctggcctcggcgctcggt
ggctggggcgccggctatctggcggaccgcatcggccgtgtgcgcacgcttcagttcacc
atcctctggttctctttcttttctctgctttgcgccttcgcgcagaattttgagcagctc
ctgatctgtcgcgccctgctcggcatcggctttggcggcgaatgggcggccggagcggtg
ctgatgggcgagaccatccgggcgcagtatcgcggccgtgccgtgggatcggtgcagtct
ggctgggccatcggctggggcgccgccgtgctggcgcaggcggccctgttctcgctcatg
ccggcagaggaggcgtggcgctggatgttcggcatcggcgcgctgccggcgctgctggtc
ctctacctgcgcagctatgtgaaggagcccgaggtctcggcccagaccatcaagcgcggg
caaacctccggcgaccggccctccatcctcgagatattccggggcccgatcctgaaggtg
accatcctcgcctcgctggtggctaccggctgccagggcggctattacgccatcaccttc
tgggtgccgcgcttcctcaccaccgaacggcatctgtccatcgtcagctccactggttat
ctggcggccctgatcgtcggctcgttcgcgggctatctggtgggcgcctggttctcggac
cgcttcggccgccgcagcctgttcctcgtgttctcgctcggcgccatggccgtggtgctc
gcctatacccagctgccgctgtcgaacgaaatactatgggtgctgggcttcccgctgggc
ttcttcgcctccggctatttctccggcatgggcgcgttcctgaccgagctctatcccacc
cggctgcgcggctcgggtcagggcttctgctacaacttcggccgcggcatcggagcgctg
ttcccgttcctggtcggctatctctcgcagaccacctcgctggccaacgccatttgcatc
ttcgcgatggtggcctatgtggtgtttttcctggccgcctatggcctgcccgagacgcgc
ggcaaggtgttgcacgccgatgcatga

DBGET integrated database retrieval system