KEGG   Azorhizobium caulinodans: AZC_3225Help
Entry
AZC_3225          CDS       T00609                                 

Definition
(GenBank) putative 2-pyrone-4,6-dicarboxylate hydrolase
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: BAF89223
RhizoBase: AZC_3225
UniProt: A8ICL6
Position
3696350..3697261
Genome map
AA seq 303 aa AA seqDB search
MTPETSAAPVCPGPAPDPHGPTRYAVPPGAVDCHAHVIGVPPAYPFVPQRSYTPPEATAE
QYLAMLDGTGMTYGVLVQVSVHGVDNRLMLDTLRANRQRLRGIAVIPLGLADRELAAMKE
AGVVGLRLNVLYGGGIGFDALGSYAALAREMDWHLQFLVDAADLMPIAPQLGQLPVPYVI
DHWGHFPVSRGLEDPGFQTMLALLRDGGWVKLSGAYRNSVSGPPYADTIPFARRIHEAAP
DRCVWGSDWPNVANWGPMMNIGELLDLMADWVPDPVARDRVFTANAQRLYGFPPGAGVGG
GAA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggaaaccagcgccgccccggtctgtccggggccggcgcccgatccccacggc
cccacccgatacgcggtgccgccgggagccgtggattgccacgcccatgtcatcggcgtg
ccgccggcctatcccttcgtgccccagcgcagctacacgccgcctgaagccaccgccgag
cagtatctggccatgctcgatggcaccggcatgacctatggcgttctggtgcaggtgagc
gtccatggggtggacaatcgcctgatgctggacacgctgcgcgcgaaccggcagcgcctc
cgcggcatcgccgtcattccgcttggcctggcggatcgcgaattggcggcgatgaaggag
gccggcgtggtcggcctccggctcaacgtgctgtatggcggcggcatcggctttgacgcg
ctgggctcctatgccgcccttgcacgggaaatggactggcacctccagtttctggtcgat
gccgctgacctgatgccgatcgctccgcaactcggccagttgccggtgccctatgtgatc
gaccattgggggcatttcccggtgtcgcgcgggctcgaggatcccggcttccagaccatg
ctggcgctgctgcgcgacggcggctgggtgaagctgtccggcgcctatcgcaacagtgtc
tccggcccgccttatgcggacaccatccccttcgcccggcgcattcacgaggccgccccc
gaccgctgcgtctggggctccgactggccaaatgtcgccaattgggggccgatgatgaac
atcggcgaactgctcgacctgatggccgattgggtgcccgatcctgttgcccgcgatcgg
gtgtttacggccaacgcgcagcgcctctacggcttcccaccgggcgcgggtgttggcggc
ggcgccgcctga

DBGET integrated database retrieval system