KEGG   Azorhizobium caulinodans: AZC_3227Help
Entry
AZC_3227          CDS       T00609                                 

Definition
(GenBank) putative outer membrane autotransporter barrel precursor
  KO
K12685  subtilase-type serine protease [EC:3.4.21.-]
Organism
azc  Azorhizobium caulinodans
Brite
KEGG Orthology (KO) [BR:azc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3227
   02044 Secretion system [BR:azc02044]
    AZC_3227
Enzymes [BR:azc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AZC_3227
Transporters [BR:azc02000]
 Other Transporters
  Pores ion channels [TC:1]
   AZC_3227
Secretion system [BR:azc02044]
 Type V secretion system
  Autotransporter-1 (AT-1) family
   AZC_3227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Autotransporter Peptidase_S8 PATR
Motif
Other DBs
NCBI-ProteinID: BAF89225
RhizoBase: AZC_3227
UniProt: A8ICM1
Position
complement(3699991..3702981)
Genome map
AA seq 996 aa AA seqDB search
MANGAARTRQAPDREMLRAGGECDARSRFSRRNGKQAGFRWGRCLRAFVVGNFFMPSHRP
SPARRGFLLASTAVCLAAPAQAQTANPWATPEYYASQALRQINAAAAYAQGYTGAGVTVG
VMDAAVDGRHPEFSGRMVPGWDFLNNRPTGQFDNMPDDSHGTHVAGIIAAARNGEVMQGV
AFNARIMSVAYNWRVTSEDEIFASSWNYLAASGVPIVNNSVGMNDCDRAPAGPCNVTSYT
RAKVEAELPQTLAAMRATARAGVLMVFATGNETQPHPDVLAGMPYLVPELKDTWLAVNLV
SSVDLAVSWGNRCGVAKDWCLVAPGYNILSTVPLGEGFGLYRGYDTMSGTSMAAPSVSGA
AALVKEAFPWFTAHDIQQAILTTATDLGEPGVDNVYGWGMLNVGKAVLGYAMFTGTTTLD
TQGMTSTFSQDISGAGTLIKTGAGELILTGANTYSGGSWVDGGTLSINGSVASNVYVGQE
GLLRGTGQIFAQLAVAGRLAPGNSPGTLTVAGPVLMSPTATFQVDIDGTGTGTGAGNYSR
LVTTGPTGTVEVAGTLAPQLRGITGSATNSYTPTLGTTLRVIEASAGVSGSFSGLAQPIG
LAAGTRFDALYGANDLSLIVTPAAYGTLSVLGLATSRNGTAVGGALDSVRPAAGVALTGS
LGAFYQSLYTLQAAALPATLAQLSGEAHASAEAMAFDDARHIRSAVLERLDGSGVAAAPL
APGLTASVWLSGYGGWAHASGGDAAALYWDASGFVAGIDAPVTEMVRFGLAAGFGQSSGT
VGDLTSDIDNTHIDLAAYAVAEGAGWRAKAGVAYGWNDLSMTRAIGFGSVAEGLATKQDG
RTVQAFGEISRDLVLGHAQVSPYANLAYVNQRLDAFAETGGVAALSGSAQTLSTTLATLG
ARLAIGLPMGNATVTPNVNLGWQHAFGDVATEAVMTLAGSSPFRVYGVPLARDALVLGGG
LTYGFGNSVAASVAYDGLIGSDVTESSIKADLRFKF
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
ttggccaacggtgcggcccggactcgtcaggcgcccgatcgcgagatgcttcgggccggt
ggcgaatgcgacgctcggtcaagattttcgagacgcaacggcaagcaggccggttttcgc
tggggtaggtgtctgcgggctttcgttgtggggaattttttcatgccgtctcaccgaccg
tcgccggcacgccgcgggttcctgctcgcctcgacggccgtctgcctggccgcaccggcg
caggcccagaccgccaacccctgggccacgccggaatattatgcctcgcaggccctgcgc
cagatcaatgccgcagccgcatatgcgcagggctacaccggtgcgggtgtcaccgtcggc
gtgatggacgcagccgtcgacgggcggcatccggaattcagcggccggatggtgccgggc
tgggactttctgaacaaccggcccaccggccagttcgacaatatgccggacgattcccat
ggcacgcatgtcgccggcatcatcgcggccgcgcgcaacggcgaggtgatgcagggcgtg
gcattcaacgccaggatcatgtcggtcgcgtacaactggcgcgtcacctcggaggatgag
atattcgcctccagctggaactatctcgcagcgagcggtgtgccgatcgtgaacaacagc
gtcggcatgaatgattgcgatcgtgcgcccgccggcccctgcaacgtgacatcctatacc
cgcgccaaggtggaggcggaactgccgcagacgctggcggcgatgcgtgccaccgccagg
gccggcgtcctcatggtcttcgcaaccggcaacgagacccagccgcatccggatgtgctg
gcgggcatgccctatcttgttccggaactcaaagacacatggctggcggtcaatctcgtc
agttccgtggatctggcggtgagctggggcaatcgctgcggcgttgcgaaggactggtgc
ctcgtagcgccgggatacaacatcctctccaccgttccgctgggcgaggggttcggcctc
tatcgtggctatgacaccatgtccggcacgtccatggcggcaccgagcgtgtccggcgct
gcggcgctggtgaaggaggccttcccctggtttacggcccacgacatccagcaggccatt
ctcaccaccgccactgacctgggcgagccgggcgtcgacaatgtctatggatggggcatg
ctcaatgtcggcaaggccgttctcggctacgccatgttcacaggcacgaccacgctcgac
acccaggggatgacatccaccttctcgcaggacatctccggtgcggggacgctcatcaag
accggcgccggggaactgatcctgaccggtgccaacacctattccggtggaagctgggtg
gacggcggcacgttgtccatcaatggctccgtagcgtcaaacgtctatgtggggcaggag
gggctgttgcgtggcacggggcagatcttcgcccagctcgccgtggccggccgccttgcg
cccgggaactcgccgggcacgctgaccgtggcgggtccggttctgatgagccccacagcc
accttccaggtcgacatcgacggcacgggcacgggaacgggagccggcaattacagtcgc
ctcgtcaccaccgggcccacggggacggtggaggtggccggcacgcttgctccgcaactg
cgcggcatcacggggagcgccaccaacagctacaccccgacccttggcaccaccctccgg
gtcatcgaggccagcgccggcgtgtccggctcgttttcagggctcgcgcagcccatcggt
cttgccgcaggcacgcggtttgatgccctctatggtgcgaacgacctcagcctcatcgta
accccggcggcctatggcactctgtccgtgctcggactggccacaagccgcaacggcacc
gcggttggcggggcgctggacagcgtgcgtccagcggcgggcgtggcgctcacgggctcg
ctcggcgccttctatcaatccctctacaccctgcaggcagcagccctgccggcgaccttg
gcgcagctttcgggcgaggcccatgcgtcggctgaagccatggccttcgatgatgcgaga
cacatccgcagcgccgttctggagcggctcgatggcagcggcgtcgcggcggcgccgctc
gcgcccggcctcacggccagtgtgtggctttccggttatggtggatgggcccatgcctcc
ggtggagatgcagccgccctgtactgggacgccagcggctttgtcgctggcattgatgct
cccgtgaccgagatggtgcgcttcgggcttgcagcgggcttcggccagtcctcgggcacg
gtcggcgacctgacgtcggacatcgataacacccacatcgatctcgccgcatatgcggtg
gccgaaggggccggatggcgcgcaaaggccggcgttgcttacggctggaacgacctctcc
atgacccgtgccatcggcttcggaagcgtggccgaggggcttgcgaccaagcaggacggc
cggaccgttcaggcgttcggtgaaatctcgcgggatcttgtcctggggcatgcccaggtg
tcgccttacgcgaacctcgcctacgtgaatcaacgtctcgatgcgttcgccgagaccgga
ggtgttgcagccctgtccggcagtgcccaaacgctctcgaccacgcttgccacgctgggc
gcacgcctcgcaatcggcctgcccatgggcaatgccacggtcacgcccaacgtgaacctg
ggctggcagcacgcgtttggggacgtggccacggaagcggtcatgaccttggccggttcg
agcccgttccgcgtgtatggggttccgctcgcccgcgatgccctggttctcggtggggga
ctgacttacggcttcgggaattccgtcgccgccagcgtcgcctatgacgggctgatcgga
tccgatgtgaccgagagcagcatcaaggccgacctgcgcttcaaattctga

DBGET integrated database retrieval system