KEGG   Azorhizobium caulinodans: AZC_3230Help
Entry
AZC_3230          CDS       T00609                                 

Definition
(GenBank) putative transcriptional regulator
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC HTH_29 HTH_8 HTH_23
Motif
Other DBs
NCBI-ProteinID: BAF89228
RhizoBase: AZC_3230
UniProt: A8ICM9
Position
3703820..3704860
Genome map
AA seq 346 aa AA seqDB search
MGGRTRMSGGIPSRRFRTLESDKAEQFGRYHDHMAPIYDVAAEENGKAGFAADMTAYHLG
GMLVGASGFSDHAIGRSKRKIARTDMDHLLVQLHKTGGLDADAEGNVVRVRAGDISLIDL
GRPMDGHAKTSQTLDVILPRSQLPDLAQRRKTPHGAVLSGDSLMGGILGDFLLSLARRLD
AATPRDAGLLTRAAADLITTCFQSETGVAAAQEGLLLAASERARRYIDANLSKAELVPVR
VARELRMSRSSLYRLFEAEGGIAKYIRTRRLTTALYLLTHPAHAGMRIGEIAFRCGFSSE
AHFSRAFRSEFDMKPSEARKRARFEPALAAASPGEGPWIASLRPSE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgggagaacgcgcatgtcaggaggcattccgtccagaaggttccggacgctggag
tccgataaggcggaacagttcggccgctaccacgaccatatggcgcccatctacgacgta
gcggcggaggaaaatggcaaggccggctttgccgccgatatgaccgcatatcatctgggc
ggcatgctggtcggcgcttcaggcttttccgatcacgcgatcggacgaagcaagcgcaag
atcgcccggacggacatggatcacctgctggtgcaactgcacaaaaccggtgggctggac
gccgacgccgagggcaatgttgtgcgtgtgcgtgcgggtgacatctccctgatcgatctc
ggccgaccgatggacgggcatgccaagacctcgcagacgctcgacgtcatcctgccgcgt
tcccagcttccggatctggcgcaacggcgcaagacgccgcacggtgccgtgctgagcggc
gacagtctgatgggcggcattctgggggacttcctgctttccttggcacggagactggac
gccgccaccccacgcgacgccggtctcctcacccgtgcggccgccgacctgatcacaacg
tgcttccagtcggagacgggcgtcgccgcagcacaggaggggctgcttcttgcagcctct
gaacgggcgagacgctacatcgatgccaatctgtcgaaggccgagttggtgcccgtccgc
gtcgcgcgggagctgcgcatgtcgcgctcaagtctgtaccgtctgttcgaggctgaaggc
gggatcgcgaaatatatccggacgcgccggctgaccaccgccttgtacttgctgacacat
ccggcgcatgccggcatgcgcatcggcgagatcgccttccggtgcggtttcagtagcgag
gcccatttcagccgcgcattccgcagcgagttcgacatgaaacccagcgaggccaggaag
cgcgcccgcttcgaacctgccctggctgctgcctccccgggcgaggggccttggatcgcc
tcgcttcgcccctcggaatag

DBGET integrated database retrieval system