KEGG   Azorhizobium caulinodans: AZC_3276Help
Entry
AZC_3276          CDS       T00609                                 

Definition
(GenBank) putative c-type cytochrome
  KO
K08738  cytochrome c
Organism
azc  Azorhizobium caulinodans
Pathway
azc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_3276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Motif
Other DBs
NCBI-ProteinID: BAF89274
RhizoBase: AZC_3276
UniProt: A8IHH4
Position
complement(3782825..3783211)
Genome map
AA seq 128 aa AA seqDB search
MAFRQTPLIMCLALTLLGTGGAAHAQDAAAGERLFRARCASCHAVESGQNRIGPSLSGVI
GRKAGSLEGARYSQGMRALDVTWDAAQLDTYLANPRAMVPGTTMTVSVTSAADRAAITGY
LQTLSQPK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcggcagacgcccctgatcatgtgccttgccctgacactgctgggaacggga
ggcgcggcccatgcgcaggatgctgccgccggcgaacgcctgttccgcgcgcgctgtgcg
tcgtgccacgccgtcgaatccggccagaaccggatcggcccgagcctgagcggggttatc
ggccgcaaggcgggcagcctcgaaggcgcccgctattcgcaaggtatgagggcactcgat
gtgacctgggatgcggcgcagttggacacgtatctcgctaatccgcgcgcgatggtgccc
ggcacgaccatgacggtttcggtgacgagcgccgcggaccgcgccgcgatcaccggctac
ctgcagaccctttcgcagccgaagtga

DBGET integrated database retrieval system