KEGG   Azorhizobium caulinodans: AZC_3465Help
Entry
AZC_3465          CDS       T00609                                 

Definition
(GenBank) putative dehydrogenase
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00260  Glycine, serine and threonine metabolism
azc00620  Pyruvate metabolism
azc00630  Glyoxylate and dicarboxylate metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZC_3465
   00630 Glyoxylate and dicarboxylate metabolism
    AZC_3465
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZC_3465
Enzymes [BR:azc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     AZC_3465
    1.1.1.81  hydroxypyruvate reductase
     AZC_3465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 3HCDH_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: BAF89463
RhizoBase: AZC_3465
UniProt: A8IE98
Position
complement(3980799..3981740)
Genome map
AA seq 313 aa AA seqDB search
MRESLVFYSPADVAADWLAAIGEHLPGLDMHIATREGAPCPAEDVHYAVVWKPPQDFFKP
FTNLKLVVNLGAGVDALVSRTDLPDVPITRLSDPEMSKMMAGFVLMCVLRHARDIVAFER
IQKEGRWRYIHPTTPDRIRVGVMGLGELGATAAHEIARFGYPVKGWSRTPKALPGIECHH
GLEALPQFLAQTDILVVMLPLTPETRHIVNAERLAMLPKGAKFINVARGPIVDEPALVAA
LQSGHISEASLDVFEEEPLPEASPLWGMDNVLITPHLASIALPRSAAAQIAENIRRIRAG
QPVLNRVDPSRGY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgagtctcttgttttctacagtcccgccgacgtggccgccgattggctggcggcc
atcggcgagcatctcccgggcctcgacatgcacatcgccacccgcgagggcgcgccgtgt
ccggcggaggatgtgcactacgcggtggtgtggaagccgccgcaggactttttcaagccc
ttcacgaacctgaagctggtggtgaacctcggggccggcgtcgatgcactcgtctcgcgt
accgacctgccggacgtgccgatcacccgcctgtccgaccccgaaatgtcgaagatgatg
gccggcttcgtgctcatgtgcgtgctgcgccatgcccgtgacatcgtggccttcgagcgc
atccagaaggaaggccgctggcgctacatccatcccaccacgccggaccgcatccgcgtg
ggtgtgatgggccttggcgaactgggtgccaccgccgcgcacgaaatcgcccgtttcggc
tatccggtgaagggctggtcccgcacgcccaaggcactgcccggcatcgaatgccaccac
ggcctcgaggctctgccgcagtttctcgcgcagaccgatatcctcgtggtgatgctgccc
ctcactccggagacccggcacatcgtcaatgccgagcgtctcgcgatgctgccgaagggg
gcgaaattcatcaatgtcgcccgcggccccatcgtggacgagccggcgctggtggcggcg
ctccagtccggccatatctcggaagcctccctcgacgtgttcgaggaggagccgctgccg
gaggcgagcccgctctggggcatggacaacgtgctcatcacgccgcacctcgcctccatt
gccctgccgaggtcggcggcggcgcagatcgcggagaacatccgccgcatccgcgcgggc
cagccggtgctgaaccgcgtcgatccctcccgcggctactga

DBGET integrated database retrieval system