KEGG   Azorhizobium caulinodans: AZC_4015Help
Entry
AZC_4015          CDS       T00609                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00020  Citrate cycle (TCA cycle)
azc00640  Propanoate metabolism
azc00660  C5-Branched dibasic acid metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01200  Carbon metabolism
Module
azc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AZC_4015
   00640 Propanoate metabolism
    AZC_4015
   00660 C5-Branched dibasic acid metabolism
    AZC_4015
Enzymes [BR:azc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AZC_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: BAF90013
RhizoBase: AZC_4015
UniProt: A8ILC3
Position
complement(4582611..4583813)
Genome map
AA seq 400 aa AA seqDB search
MNIHEYQAKALLKTYGAPVSRGVPVLAVGEAEAAARELGGPLWVVKSQIHAGGRGKGKFK
EPEAGDKGGVRLARSVEEVKTFVEQMLGNTLVTVQTGPAGKQVNRLYIEEGSDIETEFYL
SLLVDRSTSRVSFVVSTEGGMDIEEVAHSTPEKIVSFSVDPASGIQAFHGRKVADALGLS
GDLAKQAGKLTEVLYTAFTDTDMAMLEINPLIVTKDAKLKVLDAKVTFDSNALFRHPDLL
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGESPANFLDVG
GGASEEKVTAAFKIITSDPNVKGILVNIFGGIMKCDVIARGVLAAVTAVGLKVPLVVRLE
GTNVEQGKQIIRDSGLNVIPADDLDDAAQKIVAAVKKEAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaggcgaaggccctgctgaagacctacggtgcgcccgtgtct
cgcggcgtgccggtcttggcggtgggcgaggccgaggcggccgcgcgtgagctgggcggc
ccgctctgggtcgtgaagtcgcagatccatgccggcggccgcggcaagggcaagttcaag
gagccggaagccggcgacaagggcggcgtgcggctggcccggtcggtggaagaggtgaag
accttcgtcgagcagatgctcggcaacacgctcgtgaccgtgcagaccggcccggccggc
aagcaggtgaaccgcctctacatcgaggaaggttccgacatcgagaccgagttctacctc
tcgctcctcgtggaccgctccacctcgcgcgtctccttcgtggtctccaccgaaggcggc
atggacatcgaggaagtggcgcactccacccctgagaagatcgtctccttctcggtggac
ccggcctccggcatccaggctttccacggccgcaaggtggccgatgcgctcggcctctcc
ggcgacctcgccaagcaggcgggcaagctgaccgaggtgctctacaccgccttcaccgac
accgacatggcgatgctggagatcaatccgctcatcgtcaccaaggatgccaagctgaag
gtgctggacgccaaggtgacgttcgattccaacgcgctgttccgccatccggacctgctc
gccctgcgcgacgagacggaagaggacgccaaggagatcgaagcctccaagtatgacctc
gcctacatcgcgctcgacggcacgatcggctgcatggtgaacggcgcgggcctcgcgatg
gcgaccctcgacatcatcaagctctatggcgagagcccggccaacttcctcgacgtgggc
ggcggcgccagcgaggagaaggtgacggcggccttcaagatcatcacctcggacccgaac
gtgaagggcatcctggtgaacatcttcggcggcatcatgaagtgcgacgtgatcgcgcgc
ggcgtgctcgccgcggtgaccgccgtcggcctcaaggttccgctggtggtgcgcctcgaa
ggcaccaacgtggagcagggcaagcagatcatccgcgacagcggcctgaacgtgatccct
gccgatgacctggacgatgcggcgcagaagatcgtcgcggccgtgaagaaggaagctgcg
tga

DBGET integrated database retrieval system