KEGG   Azorhizobium caulinodans: AZC_4318Help
Entry
AZC_4318          CDS       T00609                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00230  Purine metabolism
azc01100  Metabolic pathways
Module
azc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AZC_4318
Enzymes [BR:azc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AZC_4318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_22 RsgA_GTPase cobW AAA_16 ABC_tran AAA_18 MobB Sp38
Motif
Other DBs
NCBI-ProteinID: BAF90316
RhizoBase: AZC_4318
UniProt: A8HVI3
Position
4906345..4907031
Genome map
AA seq 228 aa AA seqDB search
MAAPATSHFSLPGWKPGSRSGLARRGLMLVLSSPSGAGKTTLSRRLLAEDDRITMSVSVT
TRAPRPGEVDGKDYFFVSKERFEELRDTGALLEHATVFSNLYGTPRQAVEDALSAGRDVL
FDIDWQGTQQLDQSAEQDLVKVFLLPPTAEDLEKRLRTRAQDTDDVVRQRMSKASDEISH
FTEYDYILINQDVEDSLAKLKAILQAERLKRRRLTGLAGFVKGLRDAL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcccgccacgtcccatttctcgctgccgggctggaagccgggctcccgctcc
ggcctcgcccgccgcggcctcatgctggtgctctcctcgccctccggcgcgggcaagacc
accctctcccgccgcttgctggccgaggacgaccgcatcaccatgtcggtgtcggtgacg
acccgcgcgccccgtccgggcgaggtggacggcaaggactatttcttcgtctcgaaggag
cggttcgaggaattgcgcgacaccggcgcgctgctggagcatgcgaccgtgttcagcaat
ctctacggcacgccccgccaggcggtggaggatgccctcagcgccggccgcgacgtgctc
ttcgacatcgactggcagggcacccagcagctcgaccagagtgccgagcaggatctggtg
aaggtgtttctcctgccgccgaccgccgaggatctggagaagcgcctgcgcacgcgcgcg
caggacacggacgacgtggtgcgccagcgcatgtccaaggcgtcggacgagatcagccac
ttcaccgaatatgactacatcctgatcaatcaggacgtggaggacagcctcgccaagctg
aaggccatcctccaggccgagcgcctgaagcgccgccgcctcaccggcctcgccggcttc
gtgaagggcctgcgcgacgcgctctga

DBGET integrated database retrieval system