KEGG   Azorhizobium caulinodans: AZC_4674Help
Entry
AZC_4674          CDS       T00609                                 

Gene name
bacA
Definition
(GenBank) bacitracin resistance protein
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZC_4674 (bacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:azc01011]
    AZC_4674 (bacA)
Enzymes [BR:azc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     AZC_4674 (bacA)
Peptidoglycan biosynthesis and degradation proteins [BR:azc01011]
 Precursor biosynthesis
  Diphosphatase
   AZC_4674 (bacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-ProteinID: BAF90672
RhizoBase: AZC_4674
UniProt: A8I1X0
Position
complement(5318354..5319241)
Genome map
AA seq 295 aa AA seqDB search
MRPPETTGCRRAGCGAFPVPFCGTKAPMTLGTLMEALVLGLLEGLTEFIPVSSTAHLLLA
AHFIGFESTGKTFEVLIQLGAVLAILVVYFQRFLRVAVQLPTSPGARRFVIGIVLAFLPA
AIIGVALHGFIKEVLFESPKVVCAALIFGGIVLVLLDRIPFKPRFNNAMGFPLTTALGIG
FFQCLALIPGMSRSGSTIVGAMVLGADKRSAAEFSFFLALPTMLGAFVYDFWKNRNALSM
DDGLLIAVGFVAAFCAALLVIRTLLDFVSRHGYAVFGWWRILIGGVSLIALYLGH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccgcccgagacgacaggatgccgccgcgccggctgcggcgcgtttcccgtgccc
ttctgcggaaccaaagcccccatgaccctcggcaccctgatggaagccctcgttctcggc
ctgctcgagggactgaccgagttcatcccggtctcctccaccgcccatctcctgctcgcc
gcccacttcatcggcttcgagagcaccggcaagaccttcgaggtcctgatccagctgggc
gccgtgctggcgatcctggtggtctatttccagcgcttcctgcgcgtggcggtgcaactg
cccacgagccctggcgcgcgccgcttcgtcattggcatcgtgttggccttcctgccggcg
gccatcatcggcgtggcgctgcacggcttcatcaaggaggtgctgttcgagagccccaag
gtggtctgcgcggcgctgatcttcggcggtatcgtgctggtgctgctggaccgcatcccg
ttcaagccgcgcttcaacaacgccatgggctttccgctgacgacggcgctcggcatcggc
ttcttccagtgccttgccctcattcccggcatgtcgcgctcgggctcgaccatcgtcggt
gccatggtgcttggcgcggacaagcgctcggcggcggaattctccttcttcctcgccttg
cccaccatgctgggggcgttcgtctatgacttctggaagaaccgcaacgcgctgtcgatg
gacgatggcctgctgatcgcggtgggctttgtcgccgccttctgcgcggcgctgctggtc
atccgcacgctgctcgatttcgtgtcgcggcacggctacgcggtgttcggctggtggcgc
attctcatcggcggcgtcagcctcatcgccctgtatctcggccactga

DBGET integrated database retrieval system