KEGG   Azoarcus sp. DN11: CDA09_04770Help
Entry
CDA09_04770       CDS       T05691                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00620  Pyruvate metabolism
azd00630  Glyoxylate and dicarboxylate metabolism
azd01100  Metabolic pathways
azd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CDA09_04770
   00630 Glyoxylate and dicarboxylate metabolism
    CDA09_04770
Enzymes [BR:azd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     CDA09_04770
    1.2.1.22  lactaldehyde dehydrogenase
     CDA09_04770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYH42702
UniProt: A0A3Q8HZW8
Position
1064453..1065886
Genome map
AA seq 477 aa AA seqDB search
MNKSYRNFIGNQFVDSEGGATLEVRNPANNELLGVVPASTPADVDRAVEAARRAQPAWER
LPAIERANHLRRIANKIRDNKERLARTITLEQGKILDLARVEVDFTANYMDYMAEWARRI
EGEIIPSDRPGETIFLHRKPIGVTAGVLPWNFPFFLIARKMAPALVTGNTIVIKSSEETP
LNAVEFAEIVAECGLPTGVFNLVSGAGATGAALCAHKDVGLISFTGSVDTGIRIMETASR
NLTRVNLELGGKAPAIVLDDADLELTARALHASRVLNTGQVCNAAERVYVQRGVASALAE
KVTALMAETRYGNPIAEQGLHMGPLVNRMGLDKVAALVDSARRQGAEVLTGGKVASREGF
HFEPTVLMGCRADMDVMRKEIFGPVLPLQIVEDLDEALALANDSEYGLTSSIFTRDLNAA
MKATRELRFGETYINREHFEAMQGFHAGRRKSGIGGADGKHGLYEYTETHVVYLQTT
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagtcgtaccgcaacttcatcggcaaccagttcgtggattcggaagggggcgcc
accctcgaggtgcgcaacccggcgaacaacgagctcctcggcgtcgtgcccgcttccacc
ccggcggacgtcgaccgtgccgtcgaagccgcccgtcgcgcccagccggcgtgggaaagg
ctgccggcgatcgagcgcgccaaccacctgcggcggatcgcgaacaagatccgcgacaac
aaggagcgcctggcgcgcacgatcacgctggagcagggcaagatcctcgacctcgcgcgt
gtggaagtcgactttacggccaactacatggactacatggccgaatgggcgcgccgcatt
gaaggcgagatcatccccagcgaccgtcccggcgagaccatcttcctgcatcgcaagccg
atcggcgtcacggcgggcgtgctgccgtggaacttcccgttcttcctgatcgcccgcaag
atggcgccggcgctcgtcaccggcaacaccatcgtcatcaagtcgagcgaggagacgccg
ctcaacgcggtcgagttcgccgagatcgtcgccgagtgcggcctgccgacgggcgtattc
aacctcgtcagtggcgccggtgccacgggcgcggcgctgtgcgcgcacaaggacgtcggc
ctcatcagcttcaccggcagcgtcgacaccggcatccgcatcatggagaccgcctcgcgc
aacctgacgcgcgtgaacctggaactgggcggcaaggcgccggccatcgtgctcgacgac
gccgacctcgaactcaccgcgcgcgccctgcatgcctcgcgcgtgctcaacacggggcag
gtgtgcaacgccgccgagcgcgtgtatgtgcagcgcggggtcgcgtcggcgctggcggag
aaggtcaccgcgctgatggccgaaacgcgttacggcaacccgatcgcggagcagggcctg
cacatgggcccgctggtgaaccggatgggcctcgacaaggtcgccgcgctggtcgacagc
gcgcgccgccagggtgcggaagtgctcaccggcggcaaggtcgcgagccgcgaaggcttc
cacttcgagccgaccgtgctgatgggctgccgcgccgacatggacgtgatgcggaaggaa
atcttcggcccggtgctgccgctgcagatcgtcgaagatctcgacgaagccctcgcgctc
gccaatgactccgagtacggcctgacctcgtcgatcttcacgcgcgacctcaacgcggcg
atgaaggccacgcgtgagctgcgttttggcgaaacctacatcaaccgcgagcacttcgag
gcgatgcagggcttccatgccggccggcgcaagtccggcatcggcggggccgacggcaag
cacggcctgtacgagtacaccgagacgcacgtggtctatctccagaccacctga

DBGET integrated database retrieval system