KEGG   Azoarcus sp. DN11: CDA09_05755Help
Entry
CDA09_05755       CDS       T05691                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
azd  Azoarcus sp. DN11
Brite
KEGG Orthology (KO) [BR:azd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:azd03016]
    CDA09_05755
Enzymes [BR:azd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     CDA09_05755
Transfer RNA biogenesis [BR:azd03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    CDA09_05755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AYH42893
UniProt: A0A3Q8HUD6
Position
complement(1276668..1277468)
Genome map
AA seq 266 aa AA seqDB search
MSDAIRTADAGAAAPAALAPETLPILYRDDCLVAVHKPSGLLVHRSVLDVHEERFAVQIL
RNQIGRHVHPVHRLDKGTSGVLLFALDRETAARVSAAFERQAVRKTYLAVVRGHPPLEGV
IDHPVTRRFDDAERRPDTAAKAPAQDAVTRFRRLATTELPYQVDRYPTSRYALVELAPET
GRRHQIRRHLKHLSHPIIGDATFGKGRHNRLFTQLFGVSRLLLACTRMQLAHPHTGAPLD
LNAPPADDFAQVLAALDWTQAAATTP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacgcgatccggacggccgacgcgggggcagccgcccctgcggcacttgcgccg
gaaaccctgcccatcctgtaccgcgacgactgcctcgtcgccgtgcacaagccctcgggg
ctgctcgtgcatcgctcggtcctcgacgtgcacgaggaacgcttcgcggtacagatcctg
cgcaaccagatcggccgccacgtgcacccggtgcatcgcctcgacaagggcacctcgggg
gtgctgttgttcgcgctcgaccgcgaaactgcggcgcgggtctccgccgccttcgagcgg
caggcggtgcgcaagacctacctcgccgtcgtacgcggccacccgccgctcgaaggcgtc
atcgaccatccagtgacgcgccgtttcgacgacgccgagcgccgccccgacactgccgcg
aaggcccccgcgcaggacgccgtcacccgtttccgccgactggcgacgaccgaactgccg
taccaggtcgaccgctatccgacgagccgttacgcgctcgtcgaactcgcgcccgaaacg
ggccgccgccaccagatccgccgccacctcaagcacctctcccatcccatcatcggcgac
gccacgttcggcaaggggcggcacaaccggctgttcacgcagctcttcggcgtctcgcgg
ctgctcctcgcctgtacccgcatgcagctcgcgcatccgcataccggcgcgcccctggat
ctgaacgcgccgccggcggacgacttcgcgcaggtcctcgccgcactcgactggacgcaa
gccgccgccacgacaccgtag

DBGET integrated database retrieval system