KEGG   Azoarcus sp. DN11: CDA09_11565Help
Entry
CDA09_11565       CDS       T05691                                 

Gene name
rbcL
Definition
(GenBank) ribulose-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
azd  Azoarcus sp. DN11
Pathway
azd00630  Glyoxylate and dicarboxylate metabolism
azd00710  Carbon fixation in photosynthetic organisms
azd01100  Metabolic pathways
azd01110  Biosynthesis of secondary metabolites
azd01120  Microbial metabolism in diverse environments
azd01130  Biosynthesis of antibiotics
azd01200  Carbon metabolism
Module
azd_M00165  Reductive pentose phosphate cycle (Calvin cycle)
azd_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CDA09_11565 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CDA09_11565 (rbcL)
Enzymes [BR:azd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CDA09_11565 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AYH44013
UniProt: A0A3S7UG55
Position
2529049..2530515
Genome map
AA seq 488 aa AA seqDB search
MGAPETAEAILDPKKRYRAGVLKYAQMGYWDGDYQPKETDVLALFRITPQEGVDPIEAAA
AVAGESSTATWTVVWTDRLTACDRYRAKAYRVDPVPGQPGQYFCYVAYELDLFEEGSIAN
LTASIIGNVFSFKPIKAARLEDMRLPVAYVKTFRGPPTGIVVERERLNCFGRPLLGATTK
PKLGLSGKNYGRVVYEALLGGLDFTKDDENINSQPFMHWRDRFLYVMEGVQRAAAGTGEI
KGHYLNVTAGTMEEMYKRAEFAKELGSTIIMVDLIIGWTAIQSMSNWARANDMILHMHRA
GHGTYTRQKNHGISFRVIAKWLRLAGVDHLHAGTAVGKLEGDPMTVQGYYNVCREMKNEV
DLARGIFFEQDWASIRRVMPVASGGIHAGQMHQLISLFGDDVVLQFGGGTIGHPMGIQAG
ATANRVALEAMVLARNEGRDIANEGPEILKDAARQCTPLRAALDTWGEVTFNYTSTDTSD
FVATPTAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcaccggaaaccgccgaagccatcctcgacccgaagaagcgctatcgggcgggc
gtgctgaagtacgcgcagatgggctattgggacggcgattaccagccgaaggaaaccgac
gtgctggcgctgttccgcatcacgccgcaggaaggcgtcgatccgatcgaggccgcggcg
gcggtggccggcgaatcgtcgaccgccacctggaccgtcgtctggaccgaccgcctgacc
gcgtgcgaccgctaccgcgccaaggcttaccgcgtcgacccggtgccggggcagcccggc
cagtacttctgctacgtcgcctacgagctcgacctcttcgaggaaggctcgatcgcgaac
ctcaccgcgtcgatcatcggcaacgtcttcagcttcaagccgatcaaggccgcgcgcctc
gaagacatgcgcctgccggtcgcctacgtgaagaccttccgcggccccccgaccggcatc
gtggtcgagcgcgagcggctcaactgcttcggccggccgctgctcggcgcgacgaccaag
cccaagctggggctctcgggcaagaactacggccgcgtcgtgtatgaggcgctgctcggc
ggcctcgacttcaccaaggacgacgagaacatcaactcgcagcccttcatgcactggcgc
gaccgcttcctgtacgtgatggaaggcgtccagcgcgccgccgccggcaccggcgagatc
aaggggcattacctcaacgtcaccgccggcacgatggaggagatgtacaagcgcgccgaa
ttcgcgaaggaactgggctcgacgatcatcatggtcgacctgatcatcggctggaccgcg
atccagtcgatgagcaactgggcgcgcgcgaacgacatgatcctgcacatgcaccgcgcg
ggccacggcacctacacgcggcagaagaaccacggcatctcgttccgcgtgatcgccaag
tggctgcggctcgccggcgtcgatcacctgcacgcgggcaccgcggtcggcaagctcgaa
ggcgacccgatgacggtgcagggttactacaacgtgtgccgcgagatgaagaacgaggtc
gacctcgcacgcgggatcttcttcgagcaggactgggcaagcatccgccgcgtgatgccg
gtcgcctcgggcggcatccacgcgggccagatgcaccagctgatctcgctgttcggcgac
gacgtcgtgctgcagttcggcggcggcaccatcggccatccgatgggcatccaggcaggc
gccaccgcgaaccgcgtcgcgctcgaagcgatggtgctcgcgcgcaacgaggggcgcgac
atcgccaacgaggggcccgagatcctcaaggacgccgcgcgccagtgcacgccactgcgt
gccgcgctcgatacctggggcgaggtgaccttcaactacacctcgaccgacacgtccgac
ttcgtcgcgacgccgaccgccgcctga

DBGET integrated database retrieval system