KEGG   Azoarcus sp. DN11: CDA09_21460
Entry
CDA09_21460       CDS       T05691                                 

Definition
(GenBank) bifunctional 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
azd  Azoarcus sp. DN11
Pathway
azd00621  Dioxin degradation
azd01100  Metabolic pathways
azd01120  Microbial metabolism in diverse environments
azd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    CDA09_21460
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AYH45918
UniProt: A0A3S7ULP7
Position
complement(4624002..4624331)
AA seq 109 aa
MSFEKVCEVSDIPVGEALKISGEEFDVAIFNVDGELFATQDRCTHGDWSLSEGGYLDGDV
VECSLHCGKFCVRTGKVKAYPPTKPLKVFPIHVEGNAVYIDFSAGDIVQ
NT seq 330 nt   +upstreamnt  +downstreamnt
atgagttttgagaaagtttgtgaggttagtgatatccctgtcggcgaagcgctcaaaatt
tccggcgaagaattcgatgtcgcgatcttcaatgtggacggagagctatttgcaacacaa
gatcgttgcactcacggcgattggtctctgtccgagggagggtacttggacggggatgtc
gttgagtgttcgctgcactgcgggaaattctgcgttcggacaggaaaagtcaaagcatat
ccaccgactaaaccgctgaaagtctttccgatacatgtagaaggaaatgctgtgtacatc
gattttagcgccggagatattgtccaatga

DBGET integrated database retrieval system