KEGG   Azoarcus sp. CIB: AzCIB_0634Help
Entry
AzCIB_0634        CDS       T04019                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit beta
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:azi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AzCIB_0634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:azi01007]
    AzCIB_0634
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:azi03016]
    AzCIB_0634
Enzymes [BR:azi01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     AzCIB_0634
Amino acid related enzymes [BR:azi01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AzCIB_0634
Transfer RNA biogenesis [BR:azi03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AzCIB_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: AKU10539
UniProt: A0A0K1J1H0
Position
731123..733210
Genome map
AA seq 695 aa AA seqDB search
MMNASLLVELLTEELPPKALPRLGETFAAKIFDGLKARDLVAEDRGFRWFAAPRRLAITV
PQVRSAAPAREVTEKIMPVQVALDAEGRPTPALLKKLEAKGIAPEAVASFERRMDGKAEA
LFYTRNEDGAALDAVLAGIVQDAVKALPIPKLMRWGAGDAQFVRPVHKLSMLHGERVVPG
RVLDLDSDRVTRGHRFMSRGDIALATADAYEPTLLAEGKVMPDFAERRAEIERQLLASAA
REGASLGEYADLLDEVTALVEHPTVYVGEFEAEFLAVPQECLILTMRANQKYFPLFDAAG
KLRNRFLIVSNMRLEDASNIIKGNQRVVRPRLSDARFFFEQDRKHTLDSRLPRLGPVVYH
NKLGSQLERVERLERLASAIAGKLHGDAKAAARAARLAKADLVTDMVGEFPELQGIMGRY
YALNDGEGEVVADAIQSHYQPRFAGDALPEGNVACAVALADKLDALVGFFGIGQVPTGDK
DPFGLRRAALGVLRILIEAPLPLDLAELVSEAAAGFKPGLLTAAGFEVQLLDFMFERLKN
LLRDAGHAVDVVDAVLALRPTRMDLVPAKLDAVRTFRALPEAEALAAANKRIVNILKKVE
GELPEPEVALLQEEAEKALFHRVVEVAPLVRSHMGNEDYTDALCVLAGLRAAVDTFFDEV
MVMAEEPMTRQNRLALLRQLAGLMNQVADLSRLSA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgcctccctgctcgtcgaactgctcaccgaagaactcccgcccaaggccctg
ccgcgcctgggcgaaacctttgccgcgaagatcttcgacggcctcaaggcgcgcgacctc
gtcgccgaggaccgcggcttccgctggttcgccgccccgcgccgcctcgcgattaccgtg
ccgcaggtgcgctccgccgccccggcccgtgaagtcaccgaaaagatcatgccggtgcag
gtcgcgctcgacgccgaaggccgcccgacccccgcgctgctgaagaagctcgaagccaag
ggcatcgcaccggaggccgtcgcgagcttcgagcgccgcatggacggcaaggccgaagcg
ctgttctacacccgtaacgaagacggcgccgcgctcgacgccgtgctcgccgggatcgtc
caggacgccgtcaaggcgttgccgatccccaagctgatgcgctggggcgcgggcgatgcg
cagttcgtgcgtcccgtgcacaagctctcgatgctgcacggcgagcgtgtcgtgccgggc
cgcgtcctcgacctcgactccgaccgcgtcacgcgcggccaccgtttcatgagccgcggt
gacatcgcgctcgcgaccgccgacgcctacgagccgacgctgctcgccgaaggcaaggtg
atgcccgacttcgcggagcgccgcgccgagatcgagcgccagcttctcgcttctgccgcc
cgtgagggcgccagcctgggcgagtacgccgacctcctcgatgaagtcaccgcgctggtc
gagcatccgaccgtctacgtcggcgaattcgaagctgaattcctcgccgtgccgcaggaa
tgcctgatcctgacgatgcgcgcgaaccagaagtacttcccgctcttcgatgcggccggc
aagctgcgcaaccgcttcctgatcgtgtcgaacatgcgcctcgaggacgcctccaacatc
atcaagggcaaccagcgcgtcgtgcgcccgcgcctgtcggacgcgcgcttcttcttcgag
caggaccgcaagcacaccctcgacagccgcctgccgcgtctcggtccggtcgtctatcac
aacaagctcggcagccagctcgagcgcgtcgagcgcctcgaacgtctcgcgagtgccatc
gccggcaagctgcacggcgacgccaaggcggccgcacgtgcggcccgcctcgccaaggcc
gacctcgtcaccgacatggtcggcgagttccccgaactgcagggcatcatggggcgctac
tacgcgctcaacgacggcgaaggcgaagtcgtcgccgacgcgatccagtcgcactaccag
ccgcgtttcgccggcgatgcgctgcccgagggcaacgtcgcttgcgcggttgcgctcgcc
gacaagctcgacgcgctggtcggcttcttcggtatcggccaggtgccgactggcgacaag
gatcccttcggcctgcgccgcgccgcgctgggcgtgctgcgcatcctgatcgaagcgccg
ctgccgctcgatctggccgaactggtctccgaagcggccgccggcttcaagccgggcctg
ctgaccgcggccggcttcgaggtgcagctcctcgacttcatgttcgagcgactgaagaac
ctgctgcgcgacgccggccacgcggtcgacgtcgtcgacgccgtgctcgcgctgcgcccg
acgcgcatggacctcgttcccgccaagctcgacgccgtgcgcaccttccgcgccctgccc
gaagccgaggcgctcgctgccgcgaacaagcgcatcgtcaacatcctcaagaaggtcgaa
ggcgaactgcccgagcctgaggttgcgctgctgcaggaagaggccgaaaaggcgctgttc
caccgcgtcgtcgaggtcgcgccgctggtgcgttcgcacatgggcaatgaggactacacc
gacgcactgtgcgtgctcgcgggcctgcgcgcggcggtcgacaccttcttcgacgaggtc
atggtgatggccgaggaaccgatgacgcgacagaaccgcctcgcgctgctgcgtcagctc
gcgggcctgatgaatcaggtcgccgacctgtcgcgcctgtccgcctga

DBGET integrated database retrieval system