KEGG   Azoarcus sp. CIB: AzCIB_1863Help
Entry
AzCIB_1863        CDS       T04019                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00020  Citrate cycle (TCA cycle)
azi00310  Lysine degradation
azi00380  Tryptophan metabolism
azi01100  Metabolic pathways
azi01110  Biosynthesis of secondary metabolites
azi01120  Microbial metabolism in diverse environments
azi01130  Biosynthesis of antibiotics
azi01200  Carbon metabolism
Module
azi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AzCIB_1863
  09105 Amino acid metabolism
   00310 Lysine degradation
    AzCIB_1863
   00380 Tryptophan metabolism
    AzCIB_1863
Enzymes [BR:azi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AzCIB_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AKU11758
UniProt: A0A0K1J5C9
Position
complement(2083428..2084612)
Genome map
AA seq 394 aa AA seqDB search
MLIEVKVPQLSESVSEATLVSWHKKEGDAVSRDENLIDIETDKVVLETPAPADGVLVRIV
KANGENVTSGELIAQIDTEAKAAAGAAAPAAAPTAAAAAPSAAAAASASPAARKILEEKG
IPSSDVAGSGRGGRVTKEDAVAAQPRAAVPAAAPASLALTGDRPEERVPMTRLRQRIAER
LLQSKNENAILTTFNEVNMAPVMALRKQYGDKFEKAHGVRLGFMGFFVKAAVAALKKFPV
LNASVDGTDIIYHGYIDIGIAVGSPRGLVVPILRDADQMSIADIEKKIAEFGQKAKDGKL
SLEELSGGTFSISNGGVFGSMLSTPIINPPQSAILGIHATKDRPVVENGQIVIRPINYLA
MSYDHRIIDGREAVLGLVTMKEALEDPARLILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgaagtgaaagttccgcaactgtcggaatcggtttcggaagccacgctggtt
tcctggcacaagaaggaaggcgacgcggtgtcgcgcgatgagaacctgatcgacatcgag
acggacaaggtggtcctcgagaccccggctccggccgatggcgtgctcgtcaggatcgtc
aaggcgaacggcgaaaatgtgacgtcgggcgaactgatcgcccagatcgacaccgaagcc
aaggcggccgccggtgcggcggctcctgctgctgccccgacggcggccgctgcggcaccg
tcagccgctgcggcggcttcggccagcccggctgcgcgcaaaattctcgaagagaagggc
atcccgagctccgacgtcgcgggttccggccgcggcgggcgcgtgacgaaggaagatgcg
gttgcggctcagccgcgcgctgcagttccggccgctgcgcccgcctcgctcgccctgacc
ggcgatcgtccggaagagcgcgtgccgatgacccgcctgcgccagcgcatcgccgaacgc
ctgctccagtcgaagaacgaaaacgcgatcctgacgacgttcaacgaagtgaacatggct
ccggtcatggcgctgcgcaagcagtacggcgacaagttcgagaaggcgcacggcgtgcgt
ctcggcttcatgggcttcttcgtcaaggctgcggttgctgccctgaagaagttccccgtc
ctgaatgcgtcggttgacggcacggacatcatctaccacggctacatcgacatcggtatc
gcggtcggttcgccgcgcggcctcgtcgtgcccatcctgcgtgatgctgatcagatgtcg
atcgccgacatcgagaagaagatcgccgagttcggccagaaggcgaaggacggcaagctg
tcgctcgaggagctctccggcggcacgttctccatttccaacggcggcgtgttcggttcg
atgctgtcgacgccgatcatcaacccgccgcagtcggccatccttggcatccatgcgacc
aaggaccgtccggtggtcgaaaacggccagattgtcatccgtccgatcaactacctggcc
atgtcgtacgaccaccgcatcatcgacggtcgtgaagctgtgctcggcctcgtgacgatg
aaggaagcgctggaagatcctgcccgcctgatcctcgacgtgtaa

DBGET integrated database retrieval system