KEGG   Azoarcus sp. CIB: AzCIB_3773Help
Entry
AzCIB_3773        CDS       T04019                                 

Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
azi  Azoarcus sp. CIB
Brite
KEGG Orthology (KO) [BR:azi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AzCIB_3773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AKU13666
UniProt: A0A0K1JAF2
Position
4218276..4218659
Genome map
AA seq 127 aa AA seqDB search
MSESEKYRIKVTAVAEYVPGQSAPEEDRYVFAYHITISNVGTVGAQLLSRHWIITDGAGK
VQEVRGQGVIGEQPALAPGEQFSYSSGSVLETPVGTMQGSYQMVAADGHRFDAEIPAFVL
AMPRVLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatcggaaaaataccggatcaaggttaccgcggtggcggaatacgtaccgggc
cagtccgcgccggaagaagaccgctacgtgttcgcgtaccacatcacgatcagcaacgtc
ggcaccgtcggcgcacagctcctcagccgccactggatcatcaccgacggtgccggcaaa
gtgcaggaagtgcgtggccaaggcgtgatcggtgaacagccggcgctcgcgcccggagaa
cagttcagttattcgagcggctcggtgctcgaaacgccagtcggcacgatgcagggcagc
taccagatggtcgccgcggacggacaccgcttcgacgccgagatcccggccttcgtgctc
gcgatgccgcgcgtgctgcactga

DBGET integrated database retrieval system