KEGG   Azoarcus sp. CIB: AzCIB_4145Help
Entry
AzCIB_4145        CDS       T04019                                 

Definition
(GenBank) coenzyme A transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00020  Citrate cycle (TCA cycle)
azi00620  Pyruvate metabolism
azi00650  Butanoate metabolism
azi01100  Metabolic pathways
azi01110  Biosynthesis of secondary metabolites
azi01120  Microbial metabolism in diverse environments
azi01130  Biosynthesis of antibiotics
azi01200  Carbon metabolism
Module
azi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
azi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AzCIB_4145
   00620 Pyruvate metabolism
    AzCIB_4145
   00650 Butanoate metabolism
    AzCIB_4145
Enzymes [BR:azi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     AzCIB_4145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans
Motif
Other DBs
NCBI-ProteinID: AKU14038
UniProt: A0A0K1JBR6
Position
complement(4615756..4617267)
Genome map
AA seq 503 aa AA seqDB search
MNKENRIHCAALRSKVMSANEAASLIQSGMNVGMSGFTGAGYPKAVPSALAKRIMDANVN
GKRFKIGVWTGASTAPDLDGALAMVDGIEMRLPYQSDPTCRKRINAGEMEYIDIHLSHVA
QFVWFGFLGKLDVAVVEVAGILEDGRLIPSSSIGNNKTWLDQADKVILEVNSWQSSQLEG
MHDIWYGTQLPPNRQPIPLVRSSDRIGEPYLRCDPEKVIAVVETHAPDRNSAFSPPDESS
KKIAGHILEFLQYEVKKGRLPRELLPLQSGVGNIANAVMAGLNEGPFENLTAYTEVLQDG
MLEMLKSGKLASASATAFSLSNEALAELNADLARYRERIILRPQEISNHPEVIRRLGVIA
MNGMIEADIYGNVNSTHVMGSQIMNGIGGSGDFARNAYLSIFMTPSQAKNGAISCIVPMA
SHVDHTEHDVQVLVTEQGLADLRGLSPKQRAKAIIENCAHPNFRPALSDYYKRALQFSPG
KQTPHLLEEVFGWHLRALRGERM
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagaaaaccgcatccattgtgcggcgctgcgcagcaaggtcatgtccgccaac
gaggcggcgagcctgatccagtcgggcatgaacgtgggcatgagcggcttcaccggcgcg
ggctacccgaaagccgtgccgtcggcgctcgccaaacgcatcatggacgcgaacgtgaac
ggcaagcgcttcaagatcggcgtgtggacgggtgcctcgaccgcgcccgacctcgatggc
gcgctggcgatggtcgacggcatcgagatgcgcctgccctaccagtcggatccgacctgc
cgcaagcgcatcaatgccggcgagatggagtacatcgacatccacctgtcgcacgtcgcg
cagttcgtgtggttcggtttcctcggcaagctcgacgtcgcggtggtcgaggtcgccggc
atcctcgaggacgggcgcctgatcccgtcgtcgtcgatcggcaacaacaagacctggctg
gaccaggccgacaaggtgatcctcgaggtcaattcgtggcagagcagccagctcgaaggc
atgcacgacatctggtacggcacgcagctgccgccgaaccgccagccgatcccgctcgtg
cgcagttcggaccgcatcggcgagccctacctgcgttgcgacccggagaaggtgatcgcg
gtcgtcgagacgcacgcgccggaccgcaactcggcgttctcgccgccggacgagagctcg
aagaagatcgccggccacatcctggaattcttgcagtacgaggtgaagaaaggtcgtctg
ccgcgcgagctgctgccgctgcagtcgggcgtgggcaacatcgcgaacgcggtgatggcg
ggcctcaacgaggggccgttcgagaacctgaccgcttataccgaggtgctgcaggacggc
atgctggagatgctgaaatccggcaagctcgcgagcgcgtcggcgacggcgttctcgctg
agcaacgaggcgctggcggagctgaacgcggatctcgcgcgctaccgcgagcgcatcatc
ctgcgcccgcaggagatcagcaaccacccggaagtgatccgccgcctgggcgtgatcgcg
atgaacggcatgatcgaggccgacatctacggcaacgtcaattcgacgcacgtgatgggc
tcgcagatcatgaacggtatcggcggctcgggcgacttcgcgcgcaacgcgtacctgtcg
atcttcatgacgccgtcgcaggcgaagaacggcgcgatctcgtgcatcgtgccgatggcc
tcgcacgtggaccataccgagcacgacgtgcaggtgctggtcaccgagcaggggctcgcc
gacctgcgcggactgtcgcccaagcagcgcgcgaaggcgatcatcgagaactgcgcgcac
ccgaacttccgcccggcgctgtcggactattacaagcgcgcgctgcagttctcgcccggc
aagcagacgccgcacctgctcgaggaagtgttcggctggcacctgcgcgcgctgcgcggc
gagcggatgtaa

DBGET integrated database retrieval system