KEGG   Azoarcus sp. CIB: AzCIB_4158Help
Entry
AzCIB_4158        CDS       T04019                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00430  Taurine and hypotaurine metabolism
azi00620  Pyruvate metabolism
azi00640  Propanoate metabolism
azi00680  Methane metabolism
azi01100  Metabolic pathways
azi01120  Microbial metabolism in diverse environments
azi01200  Carbon metabolism
Module
azi_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AzCIB_4158
   00640 Propanoate metabolism
    AzCIB_4158
  09102 Energy metabolism
   00680 Methane metabolism
    AzCIB_4158
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    AzCIB_4158
Enzymes [BR:azi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     AzCIB_4158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AKU14051
UniProt: A0A0K1JBH8
Position
4629892..4631079
Genome map
AA seq 395 aa AA seqDB search
MKSVLVINAGSSSLKFALFPIEPELARNPALSGQIEGIGATPQLSAKDADGNRYQESVLT
GGSQGEQHKDSLNHLFRWLSAHNPDLDIVAAGHRIVHGGELHSAPVVLNESVLRDLEGFI
PLAPLHQPHNLRAVRAVAALIPEIPQVGCFDTAFHRTQSPLAQAFALPRAISAEGVKRYG
FHGLSYDYVARQLPEVIGERANGAVLIAHLGNGASMCALREGRSVATTMGFTAVEGLMMG
TRTGSLDPGVLLYLMEQKGMNAKTLTNLLYKESGLLGVSGISQDMRTLLASDAREAREAV
DLFCYRIAREIGSLAAAAGGLDALVFTGGIGEHAAPVRAQVAKLSAWLGVAIDPEANDVH
ALRIDAPDSRVAVAVVPTNEEGMIAHYTLERLAHH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcggtcctcgtcatcaacgcgggttccagcagcctcaagttcgcgcttttcccg
atcgaaccggaactcgcccgcaaccccgccctatccggacagatcgaaggcatcggcgcc
acgccgcagctgtccgccaaggacgccgacggcaaccgctatcaggaatcggtgctgacc
ggcggcagccagggcgaacagcacaaagactcgctcaaccacctgttccgctggctgagc
gcgcacaatcccgatctcgacatcgtcgctgcaggacaccgcatcgtgcacggcggcgag
ctccacagcgcaccggtggtgctcaacgagtcggtgcttcgcgacctcgaaggcttcatc
ccgctcgccccgctgcaccagccgcacaacctgcgcgccgtgcgcgccgtcgcagcgctg
atcccggagattccgcaggtcggctgcttcgacaccgcgttccatcgcacacagtccccg
cttgcccaggccttcgccctgccgcgcgcgatcagcgccgagggcgtcaagcgctacggt
ttccacggactatcctacgactacgtcgcgcgccagctccccgaggtcatcggcgaacgc
gcgaacggcgcagtgctgatcgcccatctgggcaacggcgcgtcgatgtgcgcgctgcgc
gagggccgcagcgtcgccacgacgatgggcttcaccgccgtcgagggtctgatgatgggc
acgcgcaccggtagcctggatcccggcgtgctgctctacctgatggaacagaagggcatg
aacgccaagaccctgaccaacctgctgtacaaggaatccggcctcctcggcgtctccggc
atcagccaggacatgcgcaccctgctcgcatccgatgcccgcgaggcgcgggaagcggtc
gatctgttctgctaccgcatcgcccgcgaaatcggctcgctcgccgccgcggccggcggt
ctcgatgcactcgtgttcacgggcgggataggcgagcacgccgcgccggtccgcgcccag
gtcgcgaagctctccgcctggctgggcgtcgccatcgacccggaagcgaacgacgtgcac
gcgctgcgtatcgacgcccccgacagccgcgtagccgtcgccgtcgtcccgaccaacgag
gaaggcatgatcgcccactacacgctggagcggctggcgcaccactaa

DBGET integrated database retrieval system