KEGG   Azoarcus sp. CIB: AzCIB_4205Help
Entry
AzCIB_4205        CDS       T04019                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
azi  Azoarcus sp. CIB
Pathway
azi00071  Fatty acid degradation
azi00072  Synthesis and degradation of ketone bodies
azi00280  Valine, leucine and isoleucine degradation
azi00310  Lysine degradation
azi00362  Benzoate degradation
azi00380  Tryptophan metabolism
azi00620  Pyruvate metabolism
azi00630  Glyoxylate and dicarboxylate metabolism
azi00640  Propanoate metabolism
azi00650  Butanoate metabolism
azi00900  Terpenoid backbone biosynthesis
azi01100  Metabolic pathways
azi01110  Biosynthesis of secondary metabolites
azi01120  Microbial metabolism in diverse environments
azi01130  Biosynthesis of antibiotics
azi01200  Carbon metabolism
azi01212  Fatty acid metabolism
azi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AzCIB_4205
   00630 Glyoxylate and dicarboxylate metabolism
    AzCIB_4205
   00640 Propanoate metabolism
    AzCIB_4205
   00650 Butanoate metabolism
    AzCIB_4205
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AzCIB_4205
   00072 Synthesis and degradation of ketone bodies
    AzCIB_4205
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AzCIB_4205
   00310 Lysine degradation
    AzCIB_4205
   00380 Tryptophan metabolism
    AzCIB_4205
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AzCIB_4205
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AzCIB_4205
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AzCIB_4205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:azi04147]
    AzCIB_4205
Enzymes [BR:azi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AzCIB_4205
Exosome [BR:azi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AzCIB_4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKU14098
UniProt: A0A0K1JBW9
Position
complement(4685920..4687200)
Genome map
AA seq 426 aa AA seqDB search
MSRDIFIVDGARTPFLKSRNTPGPFAASDLATAAGAALLARQRFAPDQLDEVILGCASPS
PDEVNIGRVVALRMGCGQKVPGWTVMRNCASGMQALDSAIANIQAGRSQLVLAGGVDALS
RAPLLFSDAMVRWLSGWYATKSVGEKFAALRRFRPGYLAPVIGIMKGLTDPIVGQLMGQT
AENLAHRFGISRADMDAFAARSHARVLAAREAGHFSEIVPLINRHGTVYADDDGVRADST
PENLAKLKPFFDRKYGRVTAGNSSQITDGAAWLVLASAAAVERHGLTPLGRIADSQWAGL
DPAQMGLGPVHAATPMLQRHGLGLADIDAWEVNEAFAAQVIACLRAWDDADYCRDELGLA
DAFGRLDEAKLNLDGGAIAQGHPVGASGARIVLHLLNVLRRQGLKRGVASICIGGGQGGA
MLVEAL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagccgggacatcttcatcgtcgacggcgcgcgcacgcctttcctcaagtcgcgcaac
acgccggggccgttcgcggcctccgacctcgcgaccgccgctggcgcagccctgctcgcg
cgccagcgcttcgctcccgatcagttggacgaggtgatcctgggctgcgcgagcccctcg
ccggacgaggtcaacatcggccgcgtcgtcgcgctgcgcatgggctgcgggcagaaggtg
ccgggctggacggtgatgcggaactgcgcctcgggcatgcaggcgctcgactcggcgatc
gccaacatccaggcgggacgttcgcaactggtgctcgcgggcggcgtcgatgcgctgtcg
cgcgcgccgctgctgttctccgatgcgatggtgcgctggctgtcgggctggtacgcaacg
aagagcgtcggcgagaagttcgccgcgctgcgccgcttcaggccgggctacctcgcgccg
gtgatcggcatcatgaagggcctcaccgacccgatcgtcggccagctgatgggccagacc
gcggagaacctcgcgcaccgtttcggcatctcgcgtgccgacatggacgccttcgcggcg
cgcagccacgcccgcgtgctcgccgcgcgtgaggctgggcacttcagcgagattgtgccg
ctgataaatcgccacggcaccgtgtatgcggacgacgatggcgtgcgcgcggactcgacg
cccgagaacctcgcgaagctgaaacccttcttcgaccgcaagtacggccgcgtgaccgcc
ggcaacagctcgcagatcaccgacggcgccgcgtggctggtcctcgcgtccgcagcggcg
gtcgagcgccacggcctgacgccgctggggcgcatcgccgacagccagtgggcgggcctc
gaccccgcgcagatgggcctcgggccggtgcatgcggcgacgccgatgctgcagcgccac
ggactggggctcgccgacatcgacgcgtgggaggtcaacgaggccttcgccgcgcaggtc
atcgcctgtctgcgcgcatgggacgacgcggactactgccgcgacgagttgggactggcc
gacgccttcgggcgcctcgacgaagcgaagctcaacctcgacggcggcgcgattgcgcag
ggccacccggtcggcgcgagcggtgcgcgcatcgtgctgcatctcctgaacgtgctgcgg
cggcagggcttgaaacgcggcgtcgcgagcatctgcatcggcggcgggcagggcggcgcg
atgctggtggaggcgctgtga

DBGET integrated database retrieval system