KEGG   Azoarcus sp. CIB: AzCIB_4415
Entry
AzCIB_4415        CDS       T04019                                 

Definition
(GenBank) TodB
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
azi  Azoarcus sp. CIB
Pathway
azi00621  Dioxin degradation
azi01100  Metabolic pathways
azi01120  Microbial metabolism in diverse environments
azi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    AzCIB_4415
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: AKU14308
UniProt: A0A0K1JCJ1
Position
complement(4914265..4914597)
AA seq 110 aa
MMSFEKVCEVSDIPVGEALKISGEEFDVAIFNVDGELFATQDRCTHGDWSLSEGGYLDGD
VVECSLHCGKFCVRTGKVKAYPPTKPLKVFPIHVEGNAVYIDFSAGDIVQ
NT seq 333 nt   +upstreamnt  +downstreamnt
attatgagttttgagaaagtttgtgaggttagtgatatccctgtcggcgaagcgctcaaa
atttccggcgaagaattcgatgtcgcgatcttcaatgtggacggagagctatttgcaaca
caagatcgttgcactcacggcgattggtctctgtccgagggagggtacttggacggggat
gtcgttgagtgttcgctgcactgcgggaaattctgcgttcggacaggaaaagtcaaagca
tatccaccgactaaaccgctgaaagtctttccgatacatgtagaaggaaatgctgtgtac
atcgattttagcgccggagatattgtccaatga

DBGET integrated database retrieval system