KEGG   Azospirillum sp. B510: AZL_013680Help
Entry
AZL_013680        CDS       T01169                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
azl  Azospirillum sp. B510
Pathway
azl00010  Glycolysis / Gluconeogenesis
azl00051  Fructose and mannose metabolism
azl00562  Inositol phosphate metabolism
azl00710  Carbon fixation in photosynthetic organisms
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01120  Microbial metabolism in diverse environments
azl01130  Biosynthesis of antibiotics
azl01200  Carbon metabolism
azl01230  Biosynthesis of amino acids
Module
azl_M00002  Glycolysis, core module involving three-carbon compounds
azl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZL_013680 (tpiA)
   00051 Fructose and mannose metabolism
    AZL_013680 (tpiA)
   00562 Inositol phosphate metabolism
    AZL_013680 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AZL_013680 (tpiA)
Enzymes [BR:azl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AZL_013680 (tpiA)
Exosome [BR:azl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AZL_013680 (tpiA)
  Exosomal proteins of bladder cancer cells
   AZL_013680 (tpiA)
  Exosomal proteins of melanoma cells
   AZL_013680 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAI72006
RhizoBase: AZL013680
UniProt: D3NUC7
Position
1568761..1569516
Genome map
AA seq 251 aa AA seqDB search
MTANRKLIAGNWKMNGLKADGLDLASDLAGRLKGAGPVAFDMLVCPPFQLLFPVGEAITD
SPLALGGQDCAPRNSGAHTGDIAPAMLKDAGCRFVILGHSERRADHGESDAVVNAKAAAA
LKEGLVAIICVGETEAQRDAGQANAVVSGQLAGSIPAGATAENTVIAYEPVWAIGTGKTA
TPDDVKAMHAHIRAELTGRIADPAKARILYGGSVKPGNAAELMAVENVDGALVGGASLKA
DDFWAIATACR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgaaccggaagctgatcgccggaaactggaagatgaacgggttgaaggccgat
gggctggatctcgcctccgacctcgccgggcggctgaagggtgccggcccggtcgcgttc
gacatgctggtctgcccgcccttccagctgctgtttccggtgggggaggcgatcaccgac
agcccgctggcgctgggtggtcaggactgcgcgccgaggaattccggcgcccacaccggc
gacatcgccccggccatgctgaaggacgccggatgccgattcgtcatcctcggccattcg
gagcgtcgcgccgaccatggcgagagtgacgccgtcgtcaacgccaaggccgccgccgcg
ctgaaggaaggtctggtcgccatcatctgcgtcggcgagaccgaggcgcagcgcgacgcc
ggccaggcgaacgccgtggtgtccggccagctcgccggttcgattcccgccggcgccacg
gcggagaacaccgtcatcgcctatgagccggtctgggccatcggtaccggcaagaccgcg
actccggacgacgtcaaggcgatgcacgcccatatccgggccgagctgaccggcaggatc
gccgacccggccaaggcccgcatcctctatggcggttcggtcaagccgggcaacgcggcg
gaactgatggcggtggagaatgtcgatggcgcgctggtcggcggtgcctcgctgaaggcc
gacgatttctgggccatcgccaccgcctgccgctga

DBGET integrated database retrieval system