KEGG   Azospirillum sp. B510: AZL_017770
Entry
AZL_017770        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_017770
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_017770
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: BAI72415
RhizoBase: AZL017770
UniProt: D3NVI6
Position
complement(2028331..2029665)
AA seq 444 aa
MSWDDKVIWSEGMFLRAQHFQQQDRYVERLVRGRVAGLRPFAWGISELTVNRELLAVGKF
AVLRCKGILEDGTPINIPDDDDPPPPLDLPETLANSIVYLALPVRQRGGVEFEVGESADT
ATRYVGEEGETVDAVAGSASVSRIRTGRLRLRYRLERQERAGYHCLGLARIQEVRSDRRA
TLDERYIPPALNVQALAPLAGFVTEIQGLLNSRAEALAARVGGSNGRGAGEMADFLMLQV
ANRSEPLFANIARMPDIHPERLHGMMLSLAGELATFTALNKRPPAFPPYRHDDLQGTLEP
VMAEVRRSLSAVLEQTAVPIDLQERKYGIRVGTIADRTLITTATFVLAVRADMPGETLRR
NFPALVKIGPVEQIRELVNVQLPGIRVRPLPVAPRQLPYHAGAVYFELERGSPIWKQLAT
SGGIAVHLAGDFPQVTMELWAIRG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagttgggacgacaaggtcatctggtccgaaggcatgttcctgcgggcgcagcatttc
cagcagcaggaccgctatgtcgaacggctggtgcgcggccgggtcgccggcctgcgtccc
ttcgcctggggcatcagcgagctgacggtcaaccgcgagcttctggcggtcggcaaattc
gccgtgctgcgctgcaagggcatcctggaggacgggacgccgatcaacatccccgacgac
gacgatccgccgccgccgctcgacctgcccgaaacgctggcgaacagcatcgtctatctg
gcattgccggtgcgccagcgcggcggcgtcgagttcgaggtgggcgagagcgccgacacc
gccacccgctatgtcggcgaggagggcgagacggtcgacgccgtcgccggttcggccagc
gtgtcgcgcatccgcaccgggcggttgcggctgcgctaccggctggagcggcaggaacgg
gccggctaccactgcctgggcctcgcccgcatccaggaggtgcggtcggaccgccgcgcc
acgctggacgagcgctacatcccgcctgccctcaatgtccaggcgctggcgccgctggcc
ggcttcgtcaccgaaatccagggactgctgaacagccgggccgaagcgctggccgcccgc
gtcggcgggtccaacgggcgcggcgccggcgagatggccgacttcctgatgctccaggtc
gccaaccgcagcgagccgctgttcgccaacatcgcccgcatgcccgacatccatcccgaa
cggctgcacggcatgatgctgtcgctggccggcgaactggccaccttcaccgcgctgaac
aagcgtccgcccgccttcccgccctatcggcacgacgacctccagggcacgctggaaccg
gtgatggcggaggttcgccgctcgctcagcgcggtgctggagcagacggcggttcccatc
gatcttcaggagcgcaaatatggcatccgcgtcggcaccatcgccgaccgcacgttgatc
accaccgcgaccttcgtgctggcggtgcgggcggacatgccgggcgagaccctgcgccgc
aacttcccggcgctggtgaagatcggtccggtcgaacaaatccgcgaactggtcaatgta
cagcttcccggtatccgagtaaggccgctgccggtcgcgccgcgccagctgccctaccat
gccggcgccgtgtatttcgagctcgaacgcggtagcccgatttggaaacagcttgcaacg
tccggcggaatcgcggttcatctggcaggtgatttcccccaggtgacgatggagctttgg
gcgatccgtggctga

DBGET integrated database retrieval system