KEGG   Azospirillum sp. B510: AZL_017810
Entry
AZL_017810        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
azl  Azospirillum sp. B510
Pathway
azl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZL_017810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_017810
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_017810
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: BAI72419
RhizoBase: AZL017810
UniProt: D3NVJ0
Position
complement(2033769..2034245)
AA seq 158 aa
MAIYVKYDGIDGEATHESHKKWLDVGSLQWGVGRAISTPSGSTANREASEPSVSEVTISK
MMDSSSPKFFVESCTGAIGKKVQIHLVTTGNPGNTYAEYTLTNALVSSYSMSSGGDRPSE
SISISFTKMEYKFIPYDDKNKAGTPISVSYDLSTTKSA
NT seq 477 nt   +upstreamnt  +downstreamnt
atggcgatctatgtaaagtatgacggcatcgacggtgaggcgacgcacgagtcccacaag
aagtggctcgacgtcggttcgctccagtggggcgtcggccgcgccatcagcaccccgtcg
ggctcgaccgccaaccgcgaggcgtcggagccgtcggtgtcggaagtgaccatcagcaag
atgatggacagctcctcgccgaagttcttcgtcgagtcctgcaccggcgccatcggcaag
aaggtgcagatccacctcgtcaccaccggcaacccgggcaacacctacgccgaatacacc
ctgaccaacgccctggtctcgtcctattcgatgtcgtccggcggtgaccgtccgtcggag
tcgatctccatcagcttcaccaagatggagtacaagttcatcccctacgacgacaagaac
aaggccggcacgccgatctcggtctcctacgacctgtcgacgaccaagagcgcctga

DBGET integrated database retrieval system