KEGG   Azospirillum sp. B510: AZL_017880
Entry
AZL_017880        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_017880
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_017880
SSDB
Motif
Pfam: VipB VipB_2 DUF3386
Other DBs
NCBI-ProteinID: BAI72426
RhizoBase: AZL017880
UniProt: D3NVJ7
Position
2041006..2042499
AA seq 497 aa
MSDAQTQGATAAGAAAEGTGLSILDQAIAATKQTEPDRAQELLRTLTQEALAGTVTFNKN
LGQTISKAIAEIDAKISKQLNAIMHHEKFQKLEGSWRGLNYLVMNSETGSTLKIRVMNCP
KKDLYKDISKAVEFDQSNLFKKIYENEFGIAGGEPYGALIGDYEFTSHPEDVELLSGVSN
VAAAAFAPFISAASPKLFGFEDMTELSKPRDLEKIFDSVEYAKWRSFRESDDSRFVTLTM
PRVLARLPYGASTKPIEEFEYEEAPFDGGVARPMRHGDYCWMNAAYAMGERLTSAFSQYG
WCTAIRGAEGGGKVENLPFHTFTSDDGDSDAKCPTEIGITDRREAELSKLGFLPLCHYKN
QDYAVFFGAQTTQKAKKYDRPEATANAAISARLPYIMATSRFAHYLKIMARDKIGSFMEA
SDCEAWLNRWILNYVNGNADAGQEMKAKYPLAEAKVQVKEIPGKPGSYNAVAWMRPWLQM
EELTTSMRMVARIPQAG
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgagcgacgcacagacccagggcgccaccgccgccggcgccgccgccgagggcaccggc
ctgtcgatcctcgatcaggccatcgccgcgaccaagcagaccgagccggaccgcgcgcag
gagctgttgcgcaccctgacccaggaagcgctggccggcacggtcaccttcaacaagaat
ctgggccagacgatcagcaaggcgatcgccgagatcgacgcgaagatcagcaagcagctg
aacgcgatcatgcaccacgagaagttccagaagctggaaggttcgtggcgcggcctgaat
tatctggtcatgaactcggaaacgggctccacgctcaagatccgcgtcatgaactgcccg
aagaaggacctgtacaaggacatctccaaggcggtcgagttcgaccagagcaacctgttc
aagaagatctacgagaacgagttcggcatcgccggcggcgaaccctatggcgcgctgatc
ggcgattacgagttcaccagccaccccgaggatgtcgagctgctgagcggcgtgtcgaac
gtcgcagccgccgccttcgcgcccttcatctccgccgccagccccaagctgttcggcttc
gaggacatgaccgagctgtcgaagccacgcgacctggagaagatcttcgacagcgtcgaa
tacgccaagtggcgcagcttccgtgaaagcgacgacagccgcttcgtcacgttgaccatg
ccgcgcgtgctggcccgcctgccctatggcgccagcaccaagccgatcgaggagttcgag
tatgaggaggcgccgttcgatggcggcgtcgcccgtccgatgcggcacggcgactattgc
tggatgaacgccgcctacgcgatgggcgagcgcctgaccagcgccttctcgcaatatggc
tggtgcaccgccatccgcggcgccgagggcggcggcaaggtcgagaatctgcccttccac
accttcacctcggacgacggcgacagcgacgccaagtgcccgaccgagatcggcatcacc
gaccgccgcgaggctgagctgtcgaaactgggcttcctgccgctctgccattacaagaac
caggactacgccgtcttcttcggcgcccagaccacccagaaggccaagaagtacgaccgg
ccggaggcgaccgccaacgccgcgatctccgcccgcctgccctacatcatggcgacctcg
cgtttcgcccattacctgaagatcatggcgcgcgacaagatcggctccttcatggaggcg
agcgactgcgaggcgtggctgaaccgctggatcctgaactacgtcaacggcaacgccgac
gccggccaggagatgaaggcgaagtacccgctggccgaggccaaggtgcaggtgaaggag
attccgggcaagcccggttcctacaacgccgtcgcctggatgcgcccgtggctgcagatg
gaggagctgaccacctccatgcgcatggtcgcccgcatcccgcaggccggctga

DBGET integrated database retrieval system