KEGG   Azospirillum sp. B510: AZL_017890
Entry
AZL_017890        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11899  type VI secretion system protein ImpD
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_017890
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   AZL_017890
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: BAI72427
RhizoBase: AZL017890
UniProt: D3NVJ8
Position
2042521..2044077
AA seq 518 aa
MTGAAADPPDDDAEATVLERPLRLRAVDMALGRDRPGPLDAFLAATGPGEALRLWFGVTL
PVHDSLDKLRAALDRDIAAIDALLSEQVNAILHHRRFQALEASWRGVRTLVTQAQSSESV
VLRLLTLTWAELCRDQERAIEFDQSQLFNKIYSDEFGMPGGRPFGVLLCDYAVQHRPTRE
RPTDDVSGLKGLAQVAAAAFAPAIVGAAPELFGLETFHELGLPLDLKSVLRQAEYQRWQR
FQETEDARFLGVALPRVLMRAPHGDDPQARHGFRFREESVGGDEGGGLRLEDHCWGNAVY
GFGTVLIRSFLAHGWFADIRGAQRDVIGGGLVTELVVPDFATDAARVARKFAVEVSISDH
LERDLDDLGFIPVSRCKDTPYLVFSGNQSVQRVGQYGNATAIANARLSAMLRYMFCVARF
AHFLKVMVRDRVGSFITPEDCERDLQSWLHGYCLGNDDASLDQKARYPLREGSIQVRAIP
GKPGSYQCVIHLRPHFQLDQVFSTFKLVTELAHTGGAA
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgaccggagccgcggccgatccgcctgacgacgatgccgaggcgacggtccttgaacgg
ccgttgcgtctgcgggcggtcgacatggcgctcggccgcgaccgccccggaccgctcgac
gcctttctggcggcgacaggaccgggcgaggcgttgcgcctgtggttcggcgtcaccctg
cccgtccatgacagcctggacaagctgcgcgccgccctcgaccgcgacatcgcggcgatc
gacgcgctgctgtccgagcaggtcaacgccatcctgcatcaccgacgcttccaggcgctg
gaggcgtcgtggcgcggggtgcgcacgctggtgacgcaggcgcagtccagcgagagcgtg
gtgctgcgcttgttgaccctgacctgggccgagctttgccgcgaccaggaacgggcgatc
gagttcgaccagagccagctgttcaacaagatctacagcgacgagttcggcatgccgggc
gggcgcccgttcggcgtgctgctgtgcgattacgcggtgcagcaccgtccgacgagggaa
cggccgaccgacgatgtgtccggcctgaaggggctggcccaggtcgccgccgccgccttc
gccccggccatcgtcggggcggcgcccgagctgttcgggctggagaccttccacgagctt
ggcttgccgctggacttgaaatcggtgctgcgacaggcggaataccaacgctggcaacgc
ttccaggagaccgaggatgcgcgcttcctcggcgtggcgctgccgcgcgtgctgatgcgc
gcgccccatggcgacgacccgcaggcccgccacggcttccgcttccgcgaggagtcggtg
ggcggggatgagggcggcggcctccggctggaggatcattgctggggcaacgcggtctat
ggcttcggcaccgttctgatccgctccttcctcgcccatggctggttcgccgacatccgc
ggcgcccagcgcgatgtgatcggcggcggtttggtgacggagctggtggtgccggacttc
gccaccgacgccgcgagggtggcgcggaaattcgcggtcgaggtctcgatctccgaccat
ctggagcgggatctcgacgatctcggcttcattccggtcagccgctgcaaggacacgccc
tatctggtcttttccggcaaccagtcggtgcagcgggtcggtcaatacggcaacgccacg
gcgatcgccaacgcccggctgtcggccatgctgcgctacatgttctgcgtggcgcgcttc
gcccatttcctgaaggtgatggtgcgcgaccgcgtcggcagcttcatcacgccggaggat
tgcgagcgcgacctgcaaagctggctgcacggctattgcctgggcaacgacgacgccagc
ctggaccagaaggcgcgctatcccttgcgcgagggcagcatccaggtccgcgccattccg
ggcaagcccggcagctatcaatgcgtcatccatctgcggccacacttccagctcgaccag
gtcttctcgaccttcaagctggtgaccgaactggcccacaccggcggggcggcgtga

DBGET integrated database retrieval system