KEGG   Azospirillum sp. B510: AZL_020710Help
Entry
AZL_020710        CDS       T01169                                 

Gene name
xlyB
Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K01447  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZL_020710 (xlyB)
Enzymes [BR:azl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     AZL_020710 (xlyB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_2
Motif
Other DBs
NCBI-ProteinID: BAI72709
RhizoBase: AZL020710
UniProt: D3NWD0
Position
2373558..2374250
Genome map
AA seq 230 aa AA seqDB search
MSRFRRIDLPSPNHGPRADGARVELLILHYTGMPTAAHALERLCDPAAQVSAHYTVDEDG
TIYAHVPEDRRAWHAGRASWRGLEDVNSRSIGVEIVNPGHEFGYRPFPSVQMAAVAELCR
GILDRHAIAPADVLGHSDVAPARKEDPGELFDWSGLAAQGIGLWPTPSHEDDGPVTGAEV
AALLGRYGYDPAEPRALLAFQRHFHPGGLTGSPDAETVRRLRALLRQTGH
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcttccgccggatcgaccttccctcccccaaccacggcccgcgggccgacggc
gcgcgggtggaactgctgatcctgcactataccggcatgcccaccgccgcccacgcgctg
gagcggctgtgcgatccggcggcccaggtcagcgcccattacacggtggacgaggacggc
accatctacgcccatgtcccggaggatcgccgcgcctggcatgccggccgggcgagctgg
cgtgggctggaggatgtcaacagccgctccatcggcgtcgagatcgtcaatcccggccat
gagttcggctaccgccccttcccatccgttcagatggcggcggtggcggaactgtgccgg
gggatcctggaccgtcatgccatcgcacccgccgacgtgctcggccacagcgacgtggcg
ccggcccgcaaggaggatccgggcgaactgttcgactggtccggcctggccgcccagggg
atcgggctgtggcccacgccgtcccatgaggatgacggccccgtcaccggggcggaggtc
gccgccctgctgggacgctatgggtacgacccggccgagccgcgggcgctgctggccttc
caacgccatttccatcccggcggcctgaccggcagccccgacgcggagacggtgcggcgg
ctgcgcgcgctgctgcggcagaccgggcactga

DBGET integrated database retrieval system