KEGG   Azospirillum sp. B510: AZL_027070Help
Entry
AZL_027070        CDS       T01169                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
azl  Azospirillum sp. B510
Pathway
azl00260  Glycine, serine and threonine metabolism
azl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
azl01100  Metabolic pathways
azl01110  Biosynthesis of secondary metabolites
azl01130  Biosynthesis of antibiotics
azl01230  Biosynthesis of amino acids
Module
azl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZL_027070 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZL_027070 (trpA)
Enzymes [BR:azl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZL_027070 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: BAI73345
RhizoBase: AZL027070
UniProt: D3NY66
Position
complement(3097550..3098410)
Genome map
AA seq 286 aa AA seqDB search
MSAAVKSADILADGRIARRFNALKAEGRAGLVSFITAGDPDPATSQAVLNGLPAAGADLI
ELGMPFTDPMADGPAIQASSLRALKAGMTVRKTLDMVRGFRERDADTPIILMGYFNPIHA
YGVEPFLAAAREAGVDGLIVVDLPPEEDEELCLPAVAAGVSFVRLTTPTTDEARMPAVMR
NTSGFVYYVSIAGITGTASASNTAIDAAVARLKRHTNLPVAVGFGIKTPDQAAEVARVAD
AAVVGSAIVTRLADGIDASGAVKPGTVEDVLGFVGELAEGVRAARG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgccgccgtgaagagtgccgacatcttggccgatggccgcatcgcccgccggttc
aatgcgctgaaggcggagggacgcgccggtctggtcagcttcatcaccgccggcgatccc
gatcccgccacctcgcaggcggtgctgaacggcctgccggccgccggcgccgacctgatc
gagctcggcatgcccttcaccgatccgatggccgacggcccggcgatccaggcctcctcg
ctgcgggcgctgaaggccggcatgacggtgcgcaagacgctggacatggtccgcggcttc
cgtgagcgggatgccgacacgccgatcatcctgatgggctatttcaacccgatccacgcc
tatggggtggagcccttcctggccgccgcgcgcgaggccggggtcgacgggctgatcgtc
gtcgacctgccgccggaagaggacgaggagctgtgccttccggcggtcgcggccggcgtc
agcttcgtgcgcctgaccacgccgaccaccgacgaggcgcgcatgccggccgtgatgcgc
aacacctcgggcttcgtctattacgtgtcgatcgccggcatcaccggcaccgccagcgcg
tccaacaccgccatcgacgcggcggtcgcccggctgaagcgtcataccaacctgccggtc
gccgtcggcttcggcatcaagacgccggaccaggccgccgaggtcgcccgcgtcgccgac
gccgccgtcgtcggctccgccatcgtcactcgtctggccgatgggatcgacgcgtccggc
gcggtcaagccgggcacggtcgaggatgtgctcggcttcgtcggcgaactggccgagggt
gtgcgcgcggcgcggggctga

DBGET integrated database retrieval system