KEGG   Azospirillum sp. B510: AZL_a01570
Entry
AZL_a01570        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
Organism
azl  Azospirillum sp. B510
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: BAI73688
RhizoBase: AZLa01570
UniProt: D3NZ59
Position
pAB510a:complement(178844..179437)
AA seq 197 aa
MRILLKYPGIAGDSLLQGYSNLIFCTKFDMRTGTNDAGSLEYGAAVEDNDYDVYGIAAMQ
ENYRKVKPRSKPRTVGIDSVDLGKPIDMASPLLLKTAFADPVPGAEATIYFLRPIDTQAS
AEQSGLAGGTIGFDKFLTIVLTDVHVTSYTVSAGTSADNSGDETISLSFTKLNMTYVHYK
NGQPQNVPVEIKVAKKK
NT seq 594 nt   +upstreamnt  +downstreamnt
atgcgcattcttctcaaatatccgggcattgccggcgattcgctgctccagggctacagc
aacctgatcttctgcaccaagttcgacatgagaaccggaacgaacgacgccggctctctg
gaatacggcgcggcggtcgaggacaacgactacgacgtctatggcattgcagcgatgcag
gaaaattatcgcaaggtgaagccgcggtcgaagccgcgcacggtcgggatcgacagcgtc
gacctcggcaagcccatcgacatggcctcgccgctgttgctgaagacggcgttcgccgat
cccgtgccgggcgccgaggccacgatctacttcctgcggccgatagacacgcaagcatcg
gccgagcagtcgggcctcgccggcggcacgatcggcttcgacaagttcctgaccatcgtt
ctgacagacgtccatgtcacgtcctacacggtcagcgccggcaccagcgccgataacagt
ggcgacgagacgatctcgctgtccttcaccaaactcaacatgacttacgtccattacaag
aacggccaaccgcagaacgttccggttgaaatcaaggtggcaaagaaaaaatga

DBGET integrated database retrieval system