KEGG   Azospirillum sp. B510: AZL_a01580
Entry
AZL_a01580        CDS       T01169                                 

Definition
(GenBank) impA domain protein
  KO
K11902  type VI secretion system protein ImpA
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a01580
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a01580
SSDB
Motif
Pfam: ImpA_N T6SS_VasJ Herpes_UL25
Other DBs
NCBI-ProteinID: BAI73689
RhizoBase: AZLa01580
UniProt: D3NZ60
Position
pAB510a:complement(179445..180575)
AA seq 376 aa
MTDARTAERPLIDTERILAPIPGDLPAGEDIRYEPEFDALAEARRMDDDTDKGIWQTDDV
KRADWKGVVVGATELLASRSKDLQVAVWLVQALVQQHGPAAIAPGLSMLTGLVDAFWDGL
YPRIDEDGDTEARLAPLLWLDERLSRDLLALPIALPEPGAKSGLRLQDWQNAQRLRKLAG
RDARAYKAAIAEGEVPVERIVKDVEKTPSDFYVAQRDSLKAAEAAAHALGAALDRLAGRN
APALSRIKRTVEELCRFQEDVLRKRGVTLEPTASVAAPEAASEAAGTGDAATTPGAAAHP
AGAAWTGGPRNREEAYGMLRQIADYLEQEEPHSPTSYLVRRAASWGQLSLPELYADLLGD
RGEVGRMFSVLRLKDE
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaccgacgcgcggactgctgaacgcccactcatcgacaccgaacggattctcgcgccg
attccgggagatcttccggccggcgaggacatccgctacgagccggaattcgacgcgctg
gcggaggcgcggcgcatggatgacgacacggacaaggggatctggcagaccgacgacgtc
aagcgggccgactggaagggtgtcgtggtcggcgcaaccgaactgctggctagccgttcg
aaggatctccaggttgccgtttggctggtccaggcgctggtgcagcagcacggacccgcc
gccatcgcgccgggcctgtccatgctcaccggccttgtcgatgccttttgggacggcctc
tacccacgcatcgacgaggacggggacaccgaggcgcgcttggcgcccctgctttggctg
gacgagcgcttgtcccgcgacctcctggcgctgcccatcgctctgccggaaccgggcgcc
aagtcggggctccggctccaggactggcagaacgcccagcgcctgcgcaagctggcgggc
cgtgatgcacgcgcctacaaggccgccatcgccgaaggcgaagtgccggtggagcggatc
gtgaaggacgtcgagaagacgccctcggacttctacgtcgcccagcgtgacagcctgaag
gcggccgaggcggcggcgcacgcgctgggcgcggcgctggaccggctcgccggccgcaac
gctcccgccctctcccgtatcaagcgcacggtcgaggagctgtgccggttccaggaggat
gtcttgcgcaaacgtggtgtcaccctcgaaccgaccgcgtctgtcgccgcgcccgaagcc
gcatccgaagccgccggaaccggcgatgccgccacgacgccgggtgctgcggcgcatccg
gctggggccgcctggaccggcggtccgcgcaaccgggaagaggcgtatggaatgctccgg
cagatcgccgactatctggagcaggaggaaccgcacagcccgacctcctatctggtgcgc
cgtgcggcctcctggggtcaattgtcgttgccggaactctatgccgacctgctgggcgac
cgtggcgaggttgggaggatgttctccgtgctgcgcttgaaggacgagtga

DBGET integrated database retrieval system