KEGG   Azospirillum sp. B510: AZL_a01590Help
Entry
AZL_a01590        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
azl  Azospirillum sp. B510
Pathway
azl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZL_a01590
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a01590
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF_C
Motif
Other DBs
NCBI-ProteinID: BAI73690
RhizoBase: AZLa01590
UniProt: D3NZ61
Position
pAB510a:complement(180606..184820)
Genome map
AA seq 1404 aa AA seqDB search
MDILGTVLAGIAQNQLWFFAALLLVVLAIIAVMAVILLRAGRQPAEPPGEVKALPAPEGA
DPAAGPGASGLPATLPIVGTRDLRRLFREGLAAYRETLSRNVYLVPWYLRTGVVPGDDGG
LLTCAEEVRPPVESKDRPFGFHWRFYDRAVVIDIDDARVAWKGVLDQLARYRVMMPVDGV
ILTVPLEELDDVRRATARGTELYARLWEIQRTLGLALPVYVVVTGCDAIPGFPLFVDALP
EPMRDGMLGWSSSYALETVFRPDFVGEALQSMAAGMLALQLEVFGAASREDGAQLVALID
RLAGTEAALRAMLGIAFKRTAYQETLYVRGLYFVGRTAPETPAVFGRDLLNRKIFPEAGL
PKPTRALAATRALRHHAWPVGTAVASAAAILLLWIGVHRVNTLSDQLVPILSDIPANLQQ
LSDQRAAIQAGAPPPPIYADAAARFVQGMATLPQDPPFNPLPAAWISGVPDDVARALAVG
YRRLTLATMRDIAEDRLRRLTRDPLRVQIGAGGFDRLRAFTTEVGIAEGLARAYNTVDSR
DPNMPLDEALEFSLGSTGARGFSARLHGWGVDVPPMGGAVPAPGPGAQRPIDLAAYRGEV
TSRFRQFADAYLRELAMSGLAVARLSVAASELELLAGGARTGADAATSYTEVLAGLDEAA
RGLNLEHGAWIGTDGPVLPPEFDTLLNRLEKSELFGPTLRADIKELAQRRYDEAGTGGKS
LDSVIGRLLVQGPSGAPRLSPAAESLRQTLSVWTARRFMRSGETSGMTATPAAGASWDRA
ALETIPPLLEDYLLFDAKDLPQAPQILRPSMRAAAQHQLRRGVEQILARALAGTPAGGTI
DRAGGLTQLRESARSLRLAFPVLAETIQNFRQIGLATSADAIRDIVARQANAVLAQADRM
LEEDQLYRPDTRSLNAWIDGPLVPAQLFGQQSPTALALYLGNARQEVTALTRDVAAPVVE
ILEKPVMGGGEGSGLSAKWARIVAELDRYEGGRPNSTLAVLEKFVTTDVAAIDAASCRDT
AQFDALASDFFASRLNELKQSIADRCRLMGDQRVYMGYAEIAAAFNASLAGRFPFGPISD
NQADVAMVRAFYDAFDARQGSVIEGLRRSTRLGTAGHDALRFMETMAMAKPALTAATVTD
QTGGLLLDPTFRVNRGREAGGTNIIEWKLSTSAGSIANIGARAPLRWYPGDRVAVSLRWA
KDGKVVPVTGIGAPSAVDDATLTFAYEGPWALFALVRQHNAAQRDRSSGADTVLLFEALT
KAVPVVEDADGKEAEDKAKREGPLPLSAAPLPGKPGALSAPDARRADTRVFMALGAKRTI
VTEGKPPRDEKVALLELPSSAPLLLSAGAMPRPGFPGAPPAGLTGFPSATFGGQAVNPTD
RAFFDLQAPPGVPPLLRPANQRVY
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atggatattctcggcaccgtcctggcgggcatcgcgcagaaccagctgtggttcttcgcg
gcgctgctgctggtggtcctcgccatcatcgctgtcatggcggtgatcctgctgcgcgcc
ggccgccagccggccgagccgccgggcgaggtcaaagcgctgccggcacccgagggcgcc
gatcccgccgcggggccgggagcgtccgggctgcccgcgacgctgcccatcgtcggcacg
cgcgacctccgccgcctgttccgcgagggactggcggcctatcgcgaaacgctgtcgcgc
aacgtctatctggtcccctggtatctgcgtaccggcgtcgtccccggggacgacggcggc
ctgctgacctgcgccgaggaggtgcggccgccggtggagtccaaggaccggcccttcggc
ttccactggcgcttttacgaccgcgcggtggtaatcgacatcgacgacgcccgtgtggca
tggaagggcgtgctcgaccagcttgcccgctatcgcgtcatgatgccggtcgacggcgtg
atcctgaccgtaccgctggaggaactcgacgatgtccgccgcgccaccgcgcgcggcacc
gagctttacgcccgcctgtgggagatccagcgcactctcgggctggcgctgccggtctat
gtggtggtcaccggctgcgatgccattcccggcttcccgttgttcgtcgatgcgctgccc
gagcccatgcgcgacggcatgctcggctggtcgtcctcctacgcgctggagacggtgttc
aggcctgacttcgtcggtgaggcgcttcagtccatggctgccggcatgctggccctccag
ctcgaagtgttcggcgcggcatctcgggaggacggggcgcagctcgtggcgctgatcgac
cggctggccgggacggaggcggcgctgcgcgccatgctcggcatcgccttcaagcgcacc
gcctaccaggaaacgctgtatgtccgcggcctgtatttcgttggccggacggcgccggaa
acgcctgccgtcttcggccgcgacctgctcaaccgcaagatcttccccgaggcggggctg
cccaagccgacccgcgcgctcgccgcgacccgtgccctgcgccaccatgcctggccggtc
ggcaccgccgtcgcctctgccgccgcgatcctgctcctgtggatcggcgtgcaccgggtg
aacacgctgtcggaccagctggtgccgatcctttcggacatcccggcgaacctccagcag
ctctccgaccagcgcgctgccattcaggccggcgcgccgccgccgccgatctatgccgat
gccgccgcgcgtttcgttcagggcatggcgaccctgccgcaggacccgccgttcaatccg
ctgccggccgcctggatcagcggcgtgcccgacgatgtggcccgtgcactggccgtcggt
tatcgccggctgacgctggcgaccatgcgcgatatcgccgaggaccggttgcgccgcctg
acccgcgacccgcttcgcgtgcagatcggtgcgggcggattcgaccggctgcgcgccttc
accaccgaggtgggcatcgccgaaggcttggccagggcctacaacaccgtcgattcccgt
gatcccaatatgccgctcgacgaggcgctggagttctcgctgggctccaccggggcgcgc
ggcttctccgcacggctgcatggctggggcgtcgacgtgccgccaatgggcggtgccgtc
ccggcccccggtcccggcgcgcagcggccgatcgacctggccgcctatcgcggtgaagtc
acgagccgcttccgccagttcgccgacgcctatctgcgtgagcttgccatgagcggtctc
gccgtggcccgtctttcggttgccgccagcgagcttgagctgctggcgggaggcgcgcgc
accggcgccgacgccgcaacctcctacaccgaggtgctggcgggcctggatgaggccgcg
cgcggcctgaatttggaacacggcgcttggatcggcaccgatggcccggtgctgccgccc
gagttcgacacccttctcaaccgcctggagaagtccgagctgttcggcccgacgctgcgt
gccgacatcaaggagctggcgcaacgccggtatgatgaggccgggacgggcggtaaatcg
ctggactcggtgatcggccgactgctggtccaggggccgagcggcgcaccgcgtctctcg
ccggcggctgaaagcctgcgccagacgctcagtgtctggacggcgcgccgattcatgcgc
tcgggggagacatcgggcatgacggcgacgccggcggccggcgcctcctgggaccgcgcg
gctctggagacgattccgccgctgctggaggattacctgctgttcgatgccaaggacctg
ccgcaggctccgcagatcctgcgtccatccatgcgcgccgcagcgcagcatcagctccgc
cgcggtgtcgagcaaatccttgcccgtgcgttggcgggaacccctgccggcggcaccatc
gaccgcgccggcgggctgacccagctccgggaatcggcgcggtcgctgcgcctcgccttc
ccggtgctggccgaaacgatccagaacttccggcagatcggtctggccacgtcggccgac
gccatccgcgatatcgtcgcacggcaggccaacgccgtgctcgcccaggccgaccgcatg
ctggaggaagaccagctctaccgccccgatacccgctcgctgaatgcctggatcgacggg
ccgctggttcccgcccagctgttcggccagcagagcccgacggcgctggccctgtatctc
ggcaacgcgcggcaggaggtaacggcgctgacccgcgacgtcgcggcgccggtcgtcgaa
atcctggagaagcccgttatgggcggtggcgagggctccggtctttcggccaagtgggcc
cgcatcgtcgccgagctcgaccgctatgagggtggccgcccgaacagcacgctggccgtc
ctggagaagtttgtcaccaccgacgtggccgcaatcgatgccgccagctgccgggacacg
gcgcagttcgacgcactggccagcgatttcttcgccagccgcctgaacgagttgaagcaa
tccatcgccgaccgctgccgcctgatgggcgaccagcgcgtctacatgggctatgccgag
atcgcggcggcattcaacgcatcgctggccggccggttccccttcggcccgatcagcgac
aaccaggccgacgtcgccatggtgcgggccttctacgatgccttcgacgcccgccagggc
tccgtgatcgaggggttgcgccgttccacccgcctgggtaccgccggccatgacgccctg
cgatttatggagacgatggcgatggccaagccggcgctgacggcggccaccgtcaccgac
cagaccggtggcctgctgctcgacccgaccttccgcgtcaaccgcggccgggaggccggc
ggcaccaacatcatcgaatggaagctctccacctctgccggctccatcgccaacatcggc
gcgcgggcaccgttgcgctggtaccccggcgaccgcgttgcggtgtcactgcgctgggcg
aaggacggcaaggtcgtgccggtgaccggcattggtgcaccgtccgccgtggacgacgcc
acgctgaccttcgcctacgaggggccctgggcgctgttcgcgctggtccgccagcacaac
gccgcgcagcgcgaccgttcctccggggcggatacggtccttctgttcgaagcgctgacc
aaggcggtgccggtcgtcgaggacgcggatggcaaggaggccgaggacaaagccaagcgg
gaggggccgctgcctctgagtgccgccccgctccccggcaagccgggggcgctttccgcg
cccgacgcgcggagggcggatacgcgggtcttcatggcgctgggcgccaagcggaccatc
gtgaccgagggcaagccgccgcgcgacgagaaggtggcgttgctcgaacttccgtcgtcg
gcgccgctactgctgtcggccggcgccatgccgcggccgggctttccaggggcgcctccg
gcggggctgacgggcttcccctcggccaccttcggcggtcaggcggtcaacccgacggac
cgcgccttcttcgatctccaggctccgccgggcgtgccgccgctgctgcggccggccaac
cagcgcgtctactga

DBGET integrated database retrieval system