KEGG   Azospirillum sp. B510: AZL_a01610
Entry
AZL_a01610        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a01610
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a01610
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: BAI73692
RhizoBase: AZLa01610
UniProt: D3NZ63
Position
pAB510a:complement(185768..187111)
AA seq 447 aa
MTEARDIPEAIAWHDGMLLAPQHFQQQALRNERLLTYHAGHARPFHWGVVHLQVDRVHLV
SGLVRIRELEAIMPDGLVVHYAGDRTEPLEVDISAYADPVGQTQITIHLIVPQALADRAP
GPGEVSRFLSVEGRPVPDLNGGEEVAIARLRPRLGLFATTGPNQKPPQKFVSMPVGRATF
RNDAFVLTDFVPPTLSVAANSALGRLGGEIVRRVREKALFLAERSGVGTGNAATELADAA
RAEIRSLVTGLPTLEAQLAVGVCHPFDVYLSLCTLAGHLSAFANGAVPAKLSRYDHDDPM
SAYGEVRDFILRMIDRVKEGVARIPFTFEAGMFGLVMEEAWLKGRLVIGVRGPAASTVGE
VAAWMENCIVASHSKLETLSGLRVKGADRIALDDSGESGVAAPRGVVPFEVVVDPRYVVP
GERLEIWNPDSIGSRFRPVEITLFVTA
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaccgaggcgcgcgatattcccgaggccatcgcctggcacgacggtatgctgctggcc
ccgcagcacttccagcagcaggccctgcgcaacgagcggctgctgacctaccatgccggc
catgcccgccccttccattggggcgtcgtgcaccttcaggtggaccgcgttcatctggtg
tccgggctggtgcgtatccgcgagctggaagcgatcatgcccgacgggctggttgtccat
tacgccggcgaccgcaccgaaccgttggaggtggacatctccgcctatgccgacccggtc
ggccagacgcagatcaccatccatctgatcgttccgcaggcgcttgccgaccgcgcgccg
gggcccggcgaagtctcgcgcttcctctcggtcgaggggcgcccggttcccgacctcaac
ggcggcgaggaggtggccatcgcccgcctgcgcccgcgtcttggtctgttcgccaccacc
ggtccgaaccagaagccgccgcagaagttcgtatcgatgcccgtcggccgggcgaccttt
cgcaacgatgccttcgtgctgaccgacttcgtgccgccgacgctgtcggtggccgccaac
tcggcgctcggccgtctggggggggagatcgtgcgccgcgtgcgcgaaaaggcgctgttc
ctggccgaacgctccggcgtcggcacgggcaacgccgcgaccgaactggccgacgccgcc
cgcgccgaaatccgcagcctcgtcaccggactgccgacgctggaggcgcagctcgccgtc
ggcgtctgccatcccttcgatgtctatctctcgctgtgcactctggccggccacctctcg
gccttcgccaacggcgccgtgccggccaaactgtcgcgctacgatcatgacgacccgatg
tcggcctatggcgaggtgcgcgacttcatcctgcgcatgatcgaccgcgtcaaggaaggc
gtcgcccgcatccccttcaccttcgaggccgggatgttcggtctggtgatggaggaggct
tggctgaagggccggctggtcatcggcgtgcgcggcccggccgcctcgaccgtgggcgag
gtcgcggcctggatggagaactgcatcgtcgcctcccattccaagctggagacgctctcc
ggcctgcgggtgaagggtgccgaccgcatcgcgctcgacgacagcggcgagtccggtgtc
gccgcgccgcgtggcgtcgtgccgttcgaggtcgtggtggatccccgctacgtcgtcccc
ggcgagcggctggaaatctggaacccggacagcatcggcagccgcttccggcccgtcgag
atcacgctgttcgtcacggcctga

DBGET integrated database retrieval system