KEGG   Azospirillum sp. B510: AZL_a01700
Entry
AZL_a01700        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a01700
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a01700
SSDB
Motif
Pfam: T6SS_VipA Formin_GBD_N
Other DBs
NCBI-ProteinID: BAI73701
RhizoBase: AZLa01700
UniProt: D3NZ72
Position
pAB510a:196189..196731
AA seq 180 aa
MSESIQKKLESVRPPRVKLMYEVHTGGATEMKELPFLVGVLADLSGKPEKPLPKLKERKF
VEVDRDNFNDVLASTAPRLAFQVDNKLQADGGKLNVLLNFEDMGDFEPVQVLNQMPALAR
LFEARQKLSDLLAKLDGNDELSGLLNDVIANTEQQDELKKLLGPAETAMAPAPMEEPPAA
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtccgagagcatccagaagaaattggagagtgtccgtccgccgcgcgtcaagctgatg
tacgaggttcacaccggcggcgccaccgagatgaaggagcttccgttcctcgtcggcgtc
ctcgccgacctgagcggcaagccggaaaagccgctcccgaagctgaaggagcggaagttc
gtcgaggtcgatcgcgacaatttcaacgacgttctggcctccaccgctccacggctggcg
ttccaggtcgacaacaagcttcaggccgacggcggcaagctcaatgtgctgctgaacttc
gaggacatgggcgatttcgagccggtccaggttctgaaccagatgccggcgctggcccgc
ctgttcgaagcccggcagaagctgtccgatctactggcgaagctggacggcaacgacgag
ctgagcggcctgctcaacgacgtcattgccaacaccgagcagcaggacgagctgaagaag
ctcctcggccccgcggaaacggcgatggcgccggctcccatggaagagcccccggccgcc
tga

DBGET integrated database retrieval system