KEGG   Azospirillum sp. B510: AZL_a01710
Entry
AZL_a01710        CDS       T01169                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
azl  Azospirillum sp. B510
Brite
KEGG Orthology (KO) [BR:azl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azl02044]
    AZL_a01710
Secretion system [BR:azl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZL_a01710
SSDB
Motif
Pfam: VipB VipB_2 TssC
Other DBs
NCBI-ProteinID: BAI73702
RhizoBase: AZLa01710
UniProt: D3NZ73
Position
pAB510a:196778..198247
AA seq 489 aa
MTTEMSVESTASVNLLDRMMVEGKMAREVGQRPYARDLLAEFVDQVVAETGDAVAIDVVE
AINHRIAQIDELISLQLNEILHHEEFQKLEATWRGLNYLVTNTEAGTQLKIRVLNTSRKD
LQKDLDSAVEFDQSALFKMVYEAEYGTLGGTPYSVLIGDYEFSRHPQDMSLLEKISNVAA
AAHAPFIAAASPKMFDMDSFSELAGPRDLSKIFETAEMVKWRSFRASEDSRYVALVMPHT
LLRLPYGPKTAPVEGVNFVEDVDGRDHSKYLWGNASWALGVRITEAFAKYGWTAAIRGVE
GGGRVSGLPTHTFKTDEGDVALKCPTEIAITDRREKELNDLGFISLVHCKNTDYAAFFGG
QTANKPKVYNTDEANANARLSAMLPYMLVSSRFAHYLKVMLRDKIGSFVTRGNVQNYLNT
WIGNYILLDDDASQDMKARFPLREARVDVYEVPGRPGVYRANVFLRPHFQLEELSASIRL
VAELPAPEA
NT seq 1470 nt   +upstreamnt  +downstreamnt
gtgaccacggaaatgtccgttgagagcaccgccagcgtcaacctgctcgaccgcatgatg
gtcgagggcaagatggcccgtgaagtgggtcagcggccctacgcccgcgatctgcttgcc
gagttcgtggaccaggtcgtcgccgagaccggcgacgccgtcgccatcgacgtcgtcgag
gcgatcaaccaccgcatcgcccaaatcgacgagctgatcagccttcagctgaacgagatc
ctgcaccatgaggaattccagaagctggaagccacctggcgcggtctgaactacctcgtt
acgaacaccgaggccggcacgcagctgaagatccgcgtgctgaacacctcgcgcaaggac
ctgcagaaggatctggacagcgcggtcgagttcgaccagagcgccctgttcaagatggtc
tacgaggccgaatacggcacactcggcggcacgccctacagcgtgctcatcggcgactac
gagttcagccgccatccgcaggacatgtcgctgctcgagaagatctcgaacgtcgccgcc
gcagcccacgcgccgttcatcgccgccgcctcgcccaagatgttcgacatggacagcttc
tccgagctggccggtccgcgcgacctgtcgaagatcttcgagaccgccgagatggtgaag
tggcgctccttccgcgcatcggaagactcgcgctacgtcgccctcgtcatgccgcacacg
ctgctccgcctcccctacggcccgaagacggcgccggtcgaaggcgtgaacttcgtcgag
gacgtggacggacgcgaccattccaagtacctgtggggcaacgcttcgtgggcgctcggc
gtgcgcatcaccgaagccttcgccaagtatggctggacggcggccatccgtggcgtcgag
ggcggcggccgggtcagcggcctgcccacccacaccttcaagacggatgagggcgacgtc
gccctgaaatgcccgaccgagatcgccatcacggaccgtcgcgagaaggagctgaacgac
ctcggcttcatttcgctggtgcactgcaagaacaccgattacgcggcgttcttcgggggc
cagacggcgaacaagccgaaggtgtacaataccgacgaggccaatgcgaacgcgcggctc
tcggcgatgctgccgtacatgctcgtgtcgtcgcgtttcgcgcattacctgaaggtcatg
ctgcgcgacaagatcggctcgttcgtcacccgcggcaacgtgcagaactacctcaacacc
tggatcggcaactacatcctgctggacgacgacgcctcccaggatatgaaggcgcgcttc
ccgctgcgcgaggcacgggtggacgtctacgaggtgccgggccgtcccggcgtttaccgc
gccaacgtgttcctgcgcccgcacttccagcttgaggaactgtcggcctcgatccggctg
gttgccgagctgcccgcgccggaagcctga

DBGET integrated database retrieval system